UniProt ID | PRPS3_HUMAN | |
---|---|---|
UniProt AC | P21108 | |
Protein Name | Ribose-phosphate pyrophosphokinase 3 | |
Gene Name | PRPS1L1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 318 | |
Subcellular Localization | ||
Protein Description | Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.. | |
Protein Sequence | MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MPNIKIFSGSSH ---CCCEEEECCCCC | 44.32 | 21890473 | |
16 | Phosphorylation | GSSHQDLSQKIADRL CCCCHHHHHHHHHHH | 37.40 | 27282143 | |
18 | Acetylation | SHQDLSQKIADRLGL CCHHHHHHHHHHHCH | 36.16 | 23236377 | |
18 | Ubiquitination | SHQDLSQKIADRLGL CCHHHHHHHHHHHCH | 36.16 | 21906983 | |
22 | Methylation | LSQKIADRLGLELGK HHHHHHHHHCHHHHC | 22.95 | - | |
29 | Ubiquitination | RLGLELGKVVTKKFS HHCHHHHCHHHEECC | 46.27 | 21906983 | |
33 | Ubiquitination | ELGKVVTKKFSNQET HHHCHHHEECCCCCE | 39.96 | 22817900 | |
34 | Ubiquitination | LGKVVTKKFSNQETC HHCHHHEECCCCCEE | 44.66 | 22817900 | |
36 | Phosphorylation | KVVTKKFSNQETCVE CHHHEECCCCCEEEE | 46.62 | 24275569 | |
94 | Phosphorylation | AVIPCFPYARQDKKD EEEECCCHHCCCCCC | 8.31 | 28152594 | |
99 | Ubiquitination | FPYARQDKKDKSRSP CCHHCCCCCCCCCCH | 55.31 | 24816145 | |
176 | Acetylation | SPDAGGAKRVTSIAD CCCCCCCHHHHHHHH | 51.15 | 133507 | |
176 | Ubiquitination | SPDAGGAKRVTSIAD CCCCCCCHHHHHHHH | 51.15 | 27667366 | |
194 | Acetylation | VDFALIHKERKKANE CCEEHHCHHHHHCCC | 52.82 | 23749302 | |
194 | Ubiquitination | VDFALIHKERKKANE CCEEHHCHHHHHCCC | 52.82 | 21906983 | |
197 | Ubiquitination | ALIHKERKKANEVDC EHHCHHHHHCCCCCE | 58.28 | 22817900 | |
198 | Ubiquitination | LIHKERKKANEVDCI HHCHHHHHCCCCCEE | 63.77 | 22817900 | |
238 | Phosphorylation | LAADKLLSAGATRVY HHHHHHHHCCCCEEE | 34.78 | 28857561 | |
242 | Phosphorylation | KLLSAGATRVYAILT HHHHCCCCEEEHHHH | 21.54 | - | |
245 | Phosphorylation | SAGATRVYAILTHGI HCCCCEEEHHHHCCC | 5.66 | 28152594 | |
249 | Phosphorylation | TRVYAILTHGIFSGP CEEEHHHHCCCCCCH | 16.37 | 28152594 | |
254 | Phosphorylation | ILTHGIFSGPAISRI HHHCCCCCCHHHHHH | 41.78 | 28348404 | |
259 | Phosphorylation | IFSGPAISRINTACF CCCCHHHHHHCHHHE | 29.25 | 28348404 | |
263 | Phosphorylation | PAISRINTACFEAVV HHHHHHCHHHEEEEE | 23.56 | 30301811 | |
272 | Phosphorylation | CFEAVVVTNTIPQDE HEEEEEECCCCCCCH | 18.29 | 30301811 | |
274 | Phosphorylation | EAVVVTNTIPQDEKM EEEEECCCCCCCHHC | 25.35 | 30301811 | |
293 | Phosphorylation | KIRVIDISMILAEAI CCEEEEHHHHHHHHH | 8.95 | 28464451 | |
303 | Phosphorylation | LAEAIRRTHNGESVS HHHHHHHHCCCCEEE | 15.16 | 20068231 | |
308 | Phosphorylation | RRTHNGESVSYLFSH HHHCCCCEEEEEEEC | 20.12 | 18669648 | |
310 | Phosphorylation | THNGESVSYLFSHVP HCCCCEEEEEEECCC | 25.95 | 20068231 | |
311 | Phosphorylation | HNGESVSYLFSHVPL CCCCEEEEEEECCCC | 15.03 | 20068231 | |
314 | Phosphorylation | ESVSYLFSHVPL--- CEEEEEEECCCC--- | 22.45 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRPS3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRPS3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRPS3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRPS3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-194, AND MASS SPECTROMETRY. |