UniProt ID | PRPS1_RAT | |
---|---|---|
UniProt AC | P60892 | |
Protein Name | Ribose-phosphate pyrophosphokinase 1 | |
Gene Name | Prps1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 318 | |
Subcellular Localization | ||
Protein Description | Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.. | |
Protein Sequence | MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MPNIKIFSGSSHQDL CCCEEEECCCCCHHH | 41.04 | 27097102 | |
10 | Phosphorylation | NIKIFSGSSHQDLSQ CEEEECCCCCHHHHH | 24.37 | 27097102 | |
11 | Phosphorylation | IKIFSGSSHQDLSQK EEEECCCCCHHHHHH | 28.79 | 27097102 | |
18 | Ubiquitination | SHQDLSQKIADRLGL CCHHHHHHHHHHHCH | 36.16 | - | |
36 | Phosphorylation | KVVTKKFSNQETCVE CHHHEECCCCCEEEE | 46.62 | 16641100 | |
47 | Phosphorylation | TCVEIGESVRGEDVY EEEECCCCCCCCCEE | 16.35 | 16641100 | |
194 | Acetylation | VDFALIHKERKKANE CCEEHHCHHHHHCCC | 52.82 | 22902405 | |
212 | Ubiquitination | MVLVGDVKDRVAILV EEEECCHHHCEEEEE | 44.55 | - | |
238 | Phosphorylation | HAADKLLSAGATRVY HHHHHHHHCCCCEEE | 34.78 | 23984901 | |
242 | Phosphorylation | KLLSAGATRVYAILT HHHHCCCCEEEHHHH | 21.54 | 23984901 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRPS1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRPS1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRPS1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...