UniProt ID | PRP17_MOUSE | |
---|---|---|
UniProt AC | Q9DC48 | |
Protein Name | Pre-mRNA-processing factor 17 | |
Gene Name | Cdc40 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 579 | |
Subcellular Localization | Nucleus. | |
Protein Description | Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing.. | |
Protein Sequence | MSAAIAALAASYGSGSGSESDSDSEGSRCPLPAADSLMHLTKSPSAKLSLTVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSSVPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGDRRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSAAIAALA ------CHHHHHHHH | 26.80 | 24224561 | |
11 | Phosphorylation | AIAALAASYGSGSGS HHHHHHHHHCCCCCC | 25.15 | 25293948 | |
12 | Phosphorylation | IAALAASYGSGSGSE HHHHHHHHCCCCCCC | 15.58 | 25293948 | |
14 | Phosphorylation | ALAASYGSGSGSESD HHHHHHCCCCCCCCC | 22.89 | 25293948 | |
16 | Phosphorylation | AASYGSGSGSESDSD HHHHCCCCCCCCCCC | 40.62 | 25293948 | |
18 | Phosphorylation | SYGSGSGSESDSDSE HHCCCCCCCCCCCCC | 35.31 | 25293948 | |
20 | Phosphorylation | GSGSGSESDSDSEGS CCCCCCCCCCCCCCC | 44.08 | 25293948 | |
22 | Phosphorylation | GSGSESDSDSEGSRC CCCCCCCCCCCCCCC | 52.92 | 25293948 | |
24 | Phosphorylation | GSESDSDSEGSRCPL CCCCCCCCCCCCCCC | 48.05 | 25293948 | |
27 | Phosphorylation | SDSDSEGSRCPLPAA CCCCCCCCCCCCCHH | 27.02 | 25293948 | |
81 | Phosphorylation | PAVKEVQYNPTYETM HHHCEEECCCCCCCC | 28.43 | 25159016 | |
84 | Phosphorylation | KEVQYNPTYETMFAP CEEECCCCCCCCCCC | 30.28 | 25159016 | |
187 | Phosphorylation | KFKENDASNIDGFLG HHCCCCCCCCCCCHH | 36.86 | 19131326 | |
226 | Acetylation | ITAKRQKKGKQEEEK HHHHHHHCCCCCCCC | 64.10 | 22902405 | |
319 | Phosphorylation | KIKLWEVYGDRRCLR EEEEEEECCCHHHHH | 11.20 | 25159016 | |
396 | Phosphorylation | NLFVAGMSDKKIVQW CEEEEECCCCEEEEE | 45.41 | 28059163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP17_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRP17_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP17_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRP17_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry."; Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.; Mol. Cell. Proteomics 8:904-912(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-187, AND MASSSPECTROMETRY. |