dbPTM

PRP17_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PRP17_MOUSE
UniProt AC	Q9DC48
Protein Name	Pre-mRNA-processing factor 17
Gene Name	Cdc40
Organism	Mus musculus (Mouse).
Sequence Length	579
Subcellular Localization	Nucleus.
Protein Description	Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing..
Protein Sequence	MSAAIAALAASYGSGSGSESDSDSEGSRCPLPAADSLMHLTKSPSAKLSLTVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSSVPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGDRRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSAAIAALA ------CHHHHHHHH	26.80	24224561
11	Phosphorylation	AIAALAASYGSGSGS HHHHHHHHHCCCCCC	25.15	25293948
12	Phosphorylation	IAALAASYGSGSGSE HHHHHHHHCCCCCCC	15.58	25293948
14	Phosphorylation	ALAASYGSGSGSESD HHHHHHCCCCCCCCC	22.89	25293948
16	Phosphorylation	AASYGSGSGSESDSD HHHHCCCCCCCCCCC	40.62	25293948
18	Phosphorylation	SYGSGSGSESDSDSE HHCCCCCCCCCCCCC	35.31	25293948
20	Phosphorylation	GSGSGSESDSDSEGS CCCCCCCCCCCCCCC	44.08	25293948
22	Phosphorylation	GSGSESDSDSEGSRC CCCCCCCCCCCCCCC	52.92	25293948
24	Phosphorylation	GSESDSDSEGSRCPL CCCCCCCCCCCCCCC	48.05	25293948
27	Phosphorylation	SDSDSEGSRCPLPAA CCCCCCCCCCCCCHH	27.02	25293948
81	Phosphorylation	PAVKEVQYNPTYETM HHHCEEECCCCCCCC	28.43	25159016
84	Phosphorylation	KEVQYNPTYETMFAP CEEECCCCCCCCCCC	30.28	25159016
187	Phosphorylation	KFKENDASNIDGFLG HHCCCCCCCCCCCHH	36.86	19131326
226	Acetylation	ITAKRQKKGKQEEEK HHHHHHHCCCCCCCC	64.10	22902405
319	Phosphorylation	KIKLWEVYGDRRCLR EEEEEEECCCHHHHH	11.20	25159016
396	Phosphorylation	NLFVAGMSDKKIVQW CEEEEECCCCEEEEE	45.41	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PRP17_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PRP17_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PRP17_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PRP17_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PRP17_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry."; Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.; Mol. Cell. Proteomics 8:904-912(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-187, AND MASSSPECTROMETRY.	19131326 [Abstract]