dbPTM

PROL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PROL1_HUMAN
UniProt AC	Q99935
Protein Name	Opiorphin prepropeptide {ECO:0000312\|HGNC:HGNC:17279}
Gene Name	OPRPN {ECO:0000312\|HGNC:HGNC:17279}
Organism	Homo sapiens (Human).
Sequence Length	248
Subcellular Localization	Secreted .
Protein Description	Opiorphin is an endogenous inhibitor of neprilysin and aminopeptidase N. Inhibits the breakdown of substance P, Mca-BK2 and Met-enkephalin by neprilysin in vitro with IC(50) values of 29 uM, 33 uM and 33 uM respectively. Inhibits the breakdown of Ala-pNA by aminopeptidase N in vitro with an IC(50) of 65 uM. Has a potent analgesic effect when administered to rats by intravenous injection..
Protein Sequence	MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSPLSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRILKPPFPPIPFFLAIYLPISNPEPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTVPISSTPEPATSISAATPAASTENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Pyrrolidone_carboxylic_acid	CFTPSESQRFSRRPY HCCCCHHHCCCCCCC	46.52	-
22	Pyrrolidone_carboxylic_acid	CFTPSESQRFSRRPY HCCCCHHHCCCCCCC	46.52	17101991
22	Pyrrolidone_carboxylic_acid	CFTPSESQRFSRRPY HCCCCHHHCCCCCCC	46.52	17101991
48	Phosphorylation	RPRWVPPSPPPPYDS CCCCCCCCCCCCCCC	43.92	22210691
218	N-linked_Glycosylation	RPHTVLLNATVQVTT CCCEEEEEEEEEEEC	29.42	UniProtKB CARBOHYD

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PROL1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PROL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PROL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PROL1_HUMAN !!

Drug and Disease Associations

Kegg Disease
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PROL1_HUMAN

Related Literatures of Post-Translational Modification