UniProt ID | PRL_HUMAN | |
---|---|---|
UniProt AC | P01236 | |
Protein Name | Prolactin | |
Gene Name | PRL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization | Secreted. | |
Protein Description | Prolactin acts primarily on the mammary gland by promoting lactation.. | |
Protein Sequence | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Phosphorylation | FDRAVVLSHYIHNLS HHHHHHHHHHHHHHC | 11.57 | - | |
56 | Phosphorylation | RAVVLSHYIHNLSSE HHHHHHHHHHHHCHH | 10.66 | 22210691 | |
59 | N-linked_Glycosylation | VLSHYIHNLSSEMFS HHHHHHHHHCHHHHH | 31.87 | UniProtKB CARBOHYD | |
62 | Phosphorylation | HYIHNLSSEMFSEFD HHHHHHCHHHHHHHH | 35.93 | - | |
66 | Phosphorylation | NLSSEMFSEFDKRYT HHCHHHHHHHHHHHC | 35.72 | 22210691 | |
118 | Phosphorylation | LIVSILRSWNEPLYH HHHHHHHHCCCCHHH | 30.70 | - | |
163 | Phosphorylation | EGMELIVSQVHPETK HHHHHHHHCCCCCCC | 21.35 | 15687336 | |
179 | Phosphorylation | NEIYPVWSGLPSLQM CCEECCCCCCCCCCC | 30.59 | 16840547 | |
194 | Phosphorylation | ADEESRLSAYYNLLH CCHHHHHHHHHHHHH | 17.08 | 15687336 | |
207 | Phosphorylation | LHCLRRDSHKIDNYL HHHHHHCCCCHHHHH | 25.52 | 19555049 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PPIB_HUMAN | PPIB | physical | 10935542 | |
DQB2_HUMAN | HLA-DQB2 | physical | 26186194 | |
DQB2_HUMAN | HLA-DQB2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...