UniProt ID | PRDX6_CHICK | |
---|---|---|
UniProt AC | Q5ZJF4 | |
Protein Name | Peroxiredoxin-6 | |
Gene Name | PRDX6 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 224 | |
Subcellular Localization | Cytoplasm . Lysosome . Also found in lung secretory organelles (lamellar bodies). | |
Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. Also has phospholipase activity, and can therefore either reduce the oxidized sn-2 fatty acyl grup of phospholipids (peroxidase activity) or hydrolyze the sn-2 ester bond of phospholipids (phospholipase activity). These activities are dependent on binding to phospholipids at acidic pH and to oxidized phospholipds at cytosolic pH. Plays a role in cell protection against oxidative stress by detoxifying peroxides and in phospholipid homeostasis.. | |
Protein Sequence | MPGLLLGDEAPNFEADTTQGGIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFSKRNVKMIALSIDSVPDHLAWSKDINAYNGDQPVEKLPFPIIADKDRELAVKLGMLDPDERDKDGMPLTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTAYKKVATPVDWKCGDSVMVVPTLPDEEAKKLFPKGVFTKDLPSGKKYLRYTPQPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
176 | T | Phosphorylation | Kinase | MAPK | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRDX6_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDX6_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRDX6_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...