| UniProt ID | PRDX5_RAT | |
|---|---|---|
| UniProt AC | Q9R063 | |
| Protein Name | Peroxiredoxin-5, mitochondrial | |
| Gene Name | Prdx5 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 213 | |
| Subcellular Localization |
Isoform Mitochondrial: Mitochondrion . Isoform Cytoplasmic+peroxisomal: Cytoplasm . Peroxisome matrix . |
|
| Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.. | |
| Protein Sequence | MVQLRFCVLGSIAGSVLRASATWTCVAGRAGRKGAGWECGGARSFSSAAVTMAPIKVGDTIPSVEVFEGEPGKKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDAFVTAEWGRAHQAEGKVQLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIDKGVVKALNVEPDGTGLTCSLAPNILSQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 56 | Acetylation | AVTMAPIKVGDTIPS EEEECCEECCCCCCE | 38.82 | 22902405 | |
| 60 | Phosphorylation | APIKVGDTIPSVEVF CCEECCCCCCEEEEE | 28.94 | 25575281 | |
| 63 | Phosphorylation | KVGDTIPSVEVFEGE ECCCCCCEEEEECCC | 27.36 | 25575281 | |
| 73 | Acetylation | VFEGEPGKKVNLAEL EECCCCCCEEEHHHH | 65.35 | 22902405 | |
| 74 | Acetylation | FEGEPGKKVNLAELF ECCCCCCEEEHHHHH | 42.12 | 22902405 | |
| 74 | Succinylation | FEGEPGKKVNLAELF ECCCCCCEEEHHHHH | 42.12 | 26843850 | |
| 82 | Acetylation | VNLAELFKDKKGVLF EEHHHHHCCCCCEEE | 79.75 | 22902405 | |
| 82 | Succinylation | VNLAELFKDKKGVLF EEHHHHHCCCCCEEE | 79.75 | - | |
| 82 | Succinylation | VNLAELFKDKKGVLF EEHHHHHCCCCCEEE | 79.75 | - | |
| 84 | Acetylation | LAELFKDKKGVLFGV HHHHHCCCCCEEEEC | 52.60 | 22902405 | |
| 85 | Acetylation | AELFKDKKGVLFGVP HHHHCCCCCEEEECC | 65.47 | 22902405 | |
| 96 | Phosphorylation | FGVPGAFTPGCSKTH EECCCCCCCCCCCCC | 20.45 | 21738781 | |
| 99 | S-palmitoylation | PGAFTPGCSKTHLPG CCCCCCCCCCCCCCC | 3.87 | - | |
| 100 | Phosphorylation | GAFTPGCSKTHLPGF CCCCCCCCCCCCCCH | 46.64 | 23984901 | |
| 115 | Succinylation | VEQAGALKAKGAQVV HHHHCCCCCCCCEEE | 47.74 | - | |
| 115 | Succinylation | VEQAGALKAKGAQVV HHHHCCCCCCCCEEE | 47.74 | - | |
| 115 | Acetylation | VEQAGALKAKGAQVV HHHHCCCCCCCCEEE | 47.74 | 22902405 | |
| 145 | Acetylation | RAHQAEGKVQLLADP HHHCCCCCEEEEECC | 20.50 | 22902405 | |
| 158 | Acetylation | DPTGAFGKETDLLLD CCCCCCCCHHCEECC | 51.49 | 22902405 | |
| 170 | Phosphorylation | LLDDSLVSLFGNRRL ECCHHHHHHHCCCCH | 24.23 | 22673903 | |
| 181 | Phosphorylation | NRRLKRFSMVIDKGV CCCHHHEEEEEECCC | 19.03 | 28432305 | |
| 186 | Acetylation | RFSMVIDKGVVKALN HEEEEEECCCEEEEC | 42.34 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRDX5_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRDX5_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDX5_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PRDX5_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
