UniProt ID | PRDX2_RAT | |
---|---|---|
UniProt AC | P35704 | |
Protein Name | Peroxiredoxin-2 | |
Gene Name | Prdx2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 198 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).. | |
Protein Sequence | MASGNAHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASGNAHIG ------CCCCCCCCC | 26.58 | - | |
29 | Acetylation | DGAFKEIKLSDYRGK ECCEEEEECHHCCCC | 42.92 | 22902405 | |
92 | Succinylation | AWINTPRKEGGLGPL EEECCCCCCCCCCCC | 63.01 | 26843850 | |
110 | Phosphorylation | LLADVTKSLSQNYGV HHHHHHHHHHHHCCE | 24.72 | 27097102 | |
112 | Phosphorylation | ADVTKSLSQNYGVLK HHHHHHHHHHCCEEE | 24.38 | 27097102 | |
119 | Acetylation | SQNYGVLKNDEGIAY HHHCCEEECCCCCEE | 61.00 | 22902405 | |
151 | Phosphorylation | NDLPVGRSVDEALRL CCCCCCCCHHHHHHH | 28.17 | 26022182 | |
182 | Phosphorylation | GWKPGSDTIKPNVDD CCCCCCCCCCCCCCC | 32.37 | - | |
191 | Acetylation | KPNVDDSKEYFSKHN CCCCCCHHHHHHHCC | 64.53 | 22902405 | |
196 | Acetylation | DSKEYFSKHN----- CHHHHHHHCC----- | 36.95 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRDX2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRDX2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDX2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRDX2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...