| UniProt ID | PRDX1_RAT | |
|---|---|---|
| UniProt AC | Q63716 | |
| Protein Name | Peroxiredoxin-1 | |
| Gene Name | Prdx1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 199 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).. | |
| Protein Sequence | MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSSGNAKIG ------CCCCCCCCC | 47.13 | - | |
| 7 | Acetylation | -MSSGNAKIGHPAPS -CCCCCCCCCCCCCC | 53.90 | - | |
| 14 | Phosphorylation | KIGHPAPSFKATAVM CCCCCCCCCEEEEEC | 41.29 | 29779826 | |
| 16 | Acetylation | GHPAPSFKATAVMPD CCCCCCCEEEEECCC | 49.52 | 22902405 | |
| 18 | Phosphorylation | PAPSFKATAVMPDGQ CCCCCEEEEECCCCC | 22.00 | 16641100 | |
| 27 | Acetylation | VMPDGQFKDISLSDY ECCCCCEEEEECHHC | 46.38 | 22902405 | |
| 30 | Phosphorylation | DGQFKDISLSDYKGK CCCEEEEECHHCCCC | 31.77 | 28432305 | |
| 32 | Phosphorylation | QFKDISLSDYKGKYV CEEEEECHHCCCCEE | 31.91 | 29779826 | |
| 34 | Phosphorylation | KDISLSDYKGKYVVF EEEECHHCCCCEEEE | 20.47 | 16641100 | |
| 35 | Succinylation | DISLSDYKGKYVVFF EEECHHCCCCEEEEE | 54.65 | - | |
| 35 | Ubiquitination | DISLSDYKGKYVVFF EEECHHCCCCEEEEE | 54.65 | - | |
| 35 | Succinylation | DISLSDYKGKYVVFF EEECHHCCCCEEEEE | 54.65 | - | |
| 35 | Acetylation | DISLSDYKGKYVVFF EEECHHCCCCEEEEE | 54.65 | 22902405 | |
| 67 | Acetylation | SDRAEEFKKLNCQVI CHHHHHHHHCCCEEE | 60.68 | 22902405 | |
| 90 | Phosphorylation | CHLAWINTPKKQGGL EEEEEECCCCCCCCC | 27.61 | - | |
| 93 | Succinylation | AWINTPKKQGGLGPM EEECCCCCCCCCCCC | 56.21 | 26843850 | |
| 109 | Acetylation | IPLVSDPKRTIAQDY CCCCCCCCCCHHHHC | 68.14 | 22902405 | |
| 111 | Phosphorylation | LVSDPKRTIAQDYGV CCCCCCCCHHHHCCE | 27.13 | 29779826 | |
| 116 | Phosphorylation | KRTIAQDYGVLKADE CCCHHHHCCEEECCC | 9.32 | 29779826 | |
| 120 | Acetylation | AQDYGVLKADEGISF HHHCCEEECCCCCCE | 51.92 | 22902405 | |
| 136 | Acetylation | GLFIIDDKGILRQIT EEEEECCCCEEEEEE | 44.07 | 22902405 | |
| 152 | Phosphorylation | NDLPVGRSVDEILRL CCCCCCCCHHHHHHH | 28.17 | 30181290 | |
| 181 | Phosphorylation | PAGWKPGSDTIKPDV CCCCCCCCCCCCCCC | 39.86 | 23984901 | |
| 183 | Phosphorylation | GWKPGSDTIKPDVNK CCCCCCCCCCCCCCH | 32.37 | 23984901 | |
| 185 | Succinylation | KPGSDTIKPDVNKSK CCCCCCCCCCCCHHH | 36.94 | 26843850 | |
| 192 | Acetylation | KPDVNKSKEYFSKQK CCCCCHHHHHHHCCC | 59.03 | 165087 | |
| 194 | Phosphorylation | DVNKSKEYFSKQK-- CCCHHHHHHHCCC-- | 19.52 | 20178744 | |
| 197 | Acetylation | KSKEYFSKQK----- HHHHHHHCCC----- | 52.81 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRDX1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 90 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDX1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PRDX1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...