dbPTM

PRAF3_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PRAF3_RAT
UniProt AC	Q9ES40
Protein Name	PRA1 family protein 3
Gene Name	Arl6ip5
Organism	Rattus norvegicus (Rat).
Sequence Length	188
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . Cytoplasm . Cytoplasm, cytoskeleton . Also exists as a soluble form in the cytoplasm (PubMed:11242046). Associated with microtubules (Ref.5).
Protein Description	Regulates intracellular concentrations of taurine and glutamate (Ref.5). Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. [PubMed: 11242046 May be involved in membrane traffic]
Protein Sequence	MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGGIIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFADYISKARE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDVNLAPL -------CCCCCHHH	13.49	-
182	Phosphorylation	SINKFADYISKARE- HHHHHHHHHHHHCC-	12.03	22673903
184	Phosphorylation	NKFADYISKARE--- HHHHHHHHHHCC---	17.65	22673903
185	Ubiquitination	KFADYISKARE---- HHHHHHHHHCC----	41.74	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PRAF3_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PRAF3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PRAF3_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PRAF3_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PRAF3_RAT

Related Literatures of Post-Translational Modification