UniProt ID | PRAF2_MOUSE | |
---|---|---|
UniProt AC | Q9JIG8 | |
Protein Name | PRA1 family protein 2 | |
Gene Name | Praf2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 178 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein. |
|
Protein Description | May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis (By similarity).. | |
Protein Sequence | MSEVRLPPLRALDDFVLGSARLAAPDPGDPQRWCHRVINNLLYYQTNYLLCFGISLALAGYIRPLHTLLSALVVVVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAISLFILWAVGGAFTFLLSITAPVFLILLHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEVRLPPL ------CCCCCCCCC | 44.81 | 29514104 | |
19 | Phosphorylation | LDDFVLGSARLAAPD HCHHHHCHHHHCCCC | 13.17 | - | |
178 | Phosphorylation | GQEQEAGS------- HHHHHCCC------- | 44.06 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRAF2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRAF2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRAF2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRAF2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...