PRAF1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRAF1_MOUSE
• UniProt AC: Q9Z0S9
• Protein Name: Prenylated Rab acceptor protein 1
• Gene Name: Rabac1
• Organism: Mus musculus (Mouse).
• Sequence Length: 185
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Cytoplasm . Golgi apparatus . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . According to PubMed:11535589, it is an integral membrane protein, while other authors showed that it is cytoplasmic
• Protein Description: General Rab protein regulator required for vesicle formation from the Golgi complex. May control vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. In addition it inhibits the removal of Rab GTPases from the membrane by GDI1 (By similarity)..
• Protein Sequence: MAAQKDQQKDAEGEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQMEPADGEELQMEPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Ubiquitination	SATTLLPKLIPSGAG CHHHHHCHHCCCCCC	60.04	22790023
118	Ubiquitination	YLRTLQSKLVLFGRE HHHHHHHHHHHCCCC	29.65	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRAF1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRAF1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRAF1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of PRAF1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.