PR39_PIG - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PR39_PIG
• UniProt AC: P80054
• Protein Name: Antibacterial protein PR-39
• Gene Name: PR39
• Organism: Sus scrofa (Pig).
• Sequence Length: 172
• Subcellular Localization: Secreted.
• Protein Description: Exerts a potent antimicrobial activity against both E.coli and B.megaterium..
• Protein Sequence: METQRASLCLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLNPSIHSLDISCNEIQSVRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPGKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Pyrrolidone_carboxylic_acid	VVPSASAQALSYREA HCCCHHHHHHHHHHH	40.10	-
30	Pyrrolidone_carboxylic_acid	VVPSASAQALSYREA HCCCHHHHHHHHHHH	40.10	-
169	Proline amide	PRFPPRFPGKR---- CCCCCCCCCCC----	48.99	-
169	Amidation	PRFPPRFPGKR---- CCCCCCCCCCC----	48.99	7624374

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PR39_PIG !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PR39_PIG !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PR39_PIG !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA7_HUMAN	PSMA7	physical	10930447
PSA2_HUMAN	PSMA2	physical	10930447

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Amidation

"Structure of the gene for porcine peptide antibiotic PR-39, acathelin gene family member: comparative mapping of the locus for thehuman peptide antibiotic FALL-39.";
Gudmundsson G.H., Magnusson K.P., Chowdhary B.P., Johansson M.,Andersson L., Boman H.G.;
Proc. Natl. Acad. Sci. U.S.A. 92:7085-7089(1995).
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed: 7624374