| UniProt ID | PPR27_HUMAN | |
|---|---|---|
| UniProt AC | Q86WC6 | |
| Protein Name | Protein phosphatase 1 regulatory subunit 27 | |
| Gene Name | PPP1R27 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 154 | |
| Subcellular Localization | ||
| Protein Description | Inhibits phosphatase activity of protein phosphatase 1 (PP1) complexes.. | |
| Protein Sequence | MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MPSRTARYAR -----CCCHHHHHCC | 40.75 | 29083192 | |
| 5 | Phosphorylation | ---MPSRTARYARYS ---CCCHHHHHCCCC | 21.59 | 29083192 | |
| 8 | Phosphorylation | MPSRTARYARYSPRQ CCCHHHHHCCCCHHH | 7.93 | 26437602 | |
| 12 | Phosphorylation | TARYARYSPRQRRRR HHHHCCCCHHHHHHH | 14.19 | 26437602 | |
| 56 | Phosphorylation | FIRTRKVSLATIHPS HHHHCCCEEEEECHH | 18.47 | 22210691 | |
| 59 | Phosphorylation | TRKVSLATIHPSGLA HCCCEEEEECHHHHH | 25.72 | 24719451 | |
| 63 | Phosphorylation | SLATIHPSGLAALHE EEEEECHHHHHHHHH | 32.07 | 22210691 | |
| 81 | Ubiquitination | SGNLECVKLLVKYGA CCCHHHHHHHHHHCC | 48.00 | 22817900 | |
| 85 | Ubiquitination | ECVKLLVKYGADIHQ HHHHHHHHHCCCCHH | 37.63 | 21890473 | |
| 126 | Phosphorylation | LGADRDATNDDGDLP CCCCCCCCCCCCCCC | 43.39 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPR27_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPR27_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPR27_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PPR27_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
