| UniProt ID | PPM1L_HUMAN | |
|---|---|---|
| UniProt AC | Q5SGD2 | |
| Protein Name | Protein phosphatase 1L | |
| Gene Name | PPM1L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 360 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.. | |
| Protein Sequence | MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MIEDTMTLLSLLGR -CHHHHHHHHHHHHH | 27.00 | 24719451 | |
| 50 | Ubiquitination | DEVKTIVKSSRDAVK HHHHHHHHCCHHHHH | 38.57 | 27667366 | |
| 52 | Phosphorylation | VKTIVKSSRDAVKMV HHHHHHCCHHHHHHH | 28.58 | 24719451 | |
| 84 | Ubiquitination | VLEAEFSKTWEFKNH EEEEEEEECEEECCC | 64.08 | - | |
| 175 | Phosphorylation | ILEQQILSIDREMLE HHHHHHHHCCHHHHH | 24.87 | 24719451 | |
| 187 | Phosphorylation | MLEKLTVSYDEAGTT HHHHHCCCHHHHCCE | 22.95 | 21712546 | |
| 188 | Phosphorylation | LEKLTVSYDEAGTTC HHHHCCCHHHHCCEE | 17.29 | 21712546 | |
| 213 | Phosphorylation | TVANVGDSRGVLCDK EEEECCCCCCEEECC | 25.63 | 24505115 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPM1L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPM1L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPM1L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| M3K7_HUMAN | MAP3K7 | physical | 12556533 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
