UniProt ID | PPM1L_HUMAN | |
---|---|---|
UniProt AC | Q5SGD2 | |
Protein Name | Protein phosphatase 1L | |
Gene Name | PPM1L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 360 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.. | |
Protein Sequence | MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MIEDTMTLLSLLGR -CHHHHHHHHHHHHH | 27.00 | 24719451 | |
50 | Ubiquitination | DEVKTIVKSSRDAVK HHHHHHHHCCHHHHH | 38.57 | 27667366 | |
52 | Phosphorylation | VKTIVKSSRDAVKMV HHHHHHCCHHHHHHH | 28.58 | 24719451 | |
84 | Ubiquitination | VLEAEFSKTWEFKNH EEEEEEEECEEECCC | 64.08 | - | |
175 | Phosphorylation | ILEQQILSIDREMLE HHHHHHHHCCHHHHH | 24.87 | 24719451 | |
187 | Phosphorylation | MLEKLTVSYDEAGTT HHHHHCCCHHHHCCE | 22.95 | 21712546 | |
188 | Phosphorylation | LEKLTVSYDEAGTTC HHHHCCCHHHHCCEE | 17.29 | 21712546 | |
213 | Phosphorylation | TVANVGDSRGVLCDK EEEECCCCCCEEECC | 25.63 | 24505115 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPM1L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPM1L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPM1L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
M3K7_HUMAN | MAP3K7 | physical | 12556533 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...