| UniProt ID | PPM1B_MOUSE | |
|---|---|---|
| UniProt AC | P36993 | |
| Protein Name | Protein phosphatase 1B | |
| Gene Name | Ppm1b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 390 | |
| Subcellular Localization |
Cytoplasm, cytosol . Membrane Lipid-anchor . Weakly associates at the membrane and N-myristoylation mediates the membrane localization. |
|
| Protein Description | Enzyme with a broad specificity. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.. | |
| Protein Sequence | MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDNDGGAGDLEDSLVAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGAFLDKPK ------CCCCCCCCC | 25.65 | 23088624 | |
| 90 | Ubiquitination | EDFRAADKSGSALEP HHHHHHCCCCCCCCC | 52.57 | - | |
| 90 | Acetylation | EDFRAADKSGSALEP HHHHHHCCCCCCCCC | 52.57 | 23806337 | |
| 90 | Malonylation | EDFRAADKSGSALEP HHHHHHCCCCCCCCC | 52.57 | 26320211 | |
| 112 | Ubiquitination | GIRTGFLKIDEYMRN CCCCCCEEHHHHHHC | 45.94 | - | |
| 186 | Phosphorylation | RIQNAGGSVMIQRVN HHHHCCCCEEEEEEC | 13.95 | 29514104 | |
| 195 | Phosphorylation | MIQRVNGSLAVSRAL EEEEECCCCHHHHHH | 14.14 | 22324799 | |
| 199 | Phosphorylation | VNGSLAVSRALGDYD ECCCCHHHHHHCCCC | 13.26 | 22324799 | |
| 200 | Methylation | NGSLAVSRALGDYDY CCCCHHHHHHCCCCC | 27.51 | 16188897 | |
| 221 | Phosphorylation | GPTEQLVSPEPEVYE CCHHHCCCCCCCCEE | 31.94 | 22817900 | |
| 314 | Ubiquitination | KRDSELDKHLESRVE HCHHHHHHHHHHHHH | 63.81 | - | |
| 326 | Ubiquitination | RVEEIMQKSGEEGMP HHHHHHHHHCCCCCC | 42.94 | - | |
| 343 | Phosphorylation | AHVMRILSAENIPNL HHHHHHHCCCCCCCC | 31.03 | 20415495 | |
| 367 | Phosphorylation | RHVIEAVYSRLNPHK HHHHHHHHHHHCCCC | 8.63 | 17164333 | |
| 386 | Phosphorylation | GAGDLEDSLVAL--- CCCCHHHHHEEC--- | 18.50 | 28066266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPM1B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPM1B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPM1B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PPM1B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
