PPLA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PPLA_MOUSE
• UniProt AC: P61014
• Protein Name: Cardiac phospholamban
• Gene Name: Pln
• Organism: Mus musculus (Mouse).
• Sequence Length: 52
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass membrane protein . Sarcoplasmic reticulum membrane ; Single-pass membrane protein . Mitochondrion membrane ; Single-pass membrane protein . Membrane ; Single-pass membrane protein . Colocalizes with HAX1 a
• Protein Description: Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation..
• Protein Sequence: MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEKVQYLT -------CHHHHHHH	11.53	-
3	Ubiquitination	-----MEKVQYLTRS -----CHHHHHHHHH	33.08	22790023
16	Phosphorylation	RSAIRRASTIEMPQQ HHHHHHHHHCCCCHH	28.27	27742792
17	Phosphorylation	SAIRRASTIEMPQQA HHHHHHHHCCCCHHH	21.70	27742792
36	S-palmitoylation	QNLFINFCLILICLL HHHHHHHHHHHHHHH	1.68	26644582

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
16	S	Phosphorylation	Kinase	PRKACA	P05132	GPS
16	S	Phosphorylation	Kinase	KCC2A	P11798	PhosphoELM
16	S	Phosphorylation	Kinase	CAMK2D	P28652	GPS
16	S	Phosphorylation	Kinase	KCC2D	Q6PHZ2	PhosphoELM
16	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
16	S	Phosphorylation	Kinase	PKA	-	Uniprot
17	T	Phosphorylation	Kinase	PRKACA	P05132	GPS
17	T	Phosphorylation	Kinase	KCC2A	P11798	PhosphoELM
17	T	Phosphorylation	Kinase	CAMK2D	P28652	GPS
17	T	Phosphorylation	Kinase	CAMK2D	Q13557	PSP
17	T	Phosphorylation	Kinase	CAMK2D	Q6PHZ2	PSP
17	T	Phosphorylation	Kinase	AKT-FAMILY	-	GPS
17	T	Phosphorylation	Kinase	CAMK2-FAMILY	-	GPS
17	T	Phosphorylation	Kinase	CAMK2	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
17	T	Phosphorylation	Phosphorylated at Thr-17 by CaMK2, and in response to beta-adrenergic stimulation.	22971924

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PPLA_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of PPLA_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.