UniProt ID | PPIL1_MOUSE | |
---|---|---|
UniProt AC | Q9D0W5 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase-like 1 | |
Gene Name | Ppil1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 166 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing as component of the spliceosome. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
Protein Sequence | MAAIPPDTWQPPNVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKILKAYPSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Acetylation | KHAPKTCKNFAELAR HHCCHHHHCHHHHHH | 61.40 | 22826441 | |
58 | Acetylation | TKFHRIIKDFMIQGG CCHHHHHHHHEEECC | 42.41 | 22826441 | |
72 | Methylation | GDPTGTGRGGASIYG CCCCCCCCCCCEEEC | 39.96 | 30988925 | |
147 | Phosphorylation | NRVGMVETNSQDRPV CCEEEEEECCCCCCC | 28.85 | 28066266 | |
149 | Phosphorylation | VGMVETNSQDRPVDD EEEEEECCCCCCCCC | 40.66 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIL1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIL1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIL1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PPIL1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...