| UniProt ID | PPIE_MOUSE | |
|---|---|---|
| UniProt AC | Q9QZH3 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase E | |
| Gene Name | Ppie | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 301 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing as component of the spliceosome. Combines RNA-binding and PPIase activities. Binds mRNA and has a preference for single-stranded RNA molecules with poly-A and poly-U stretches, suggesting it binds to the poly(A)-region in the 3'-UTR of mRNA molecules. Catalyzes the cis-trans isomerization of proline imidic peptide bonds in proteins. Inhibits KMT2A activity; this requires proline isomerase activity.. | |
| Protein Sequence | MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGPEPPKAEAQEGEPTAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGEYM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | PMRIKEGSSRPVWSD CEECCCCCCCCCCCC | 25.02 | - | |
| 97 | Phosphorylation | GSSRPVWSDDDWLKK CCCCCCCCCHHHHHH | 31.25 | 26745281 | |
| 109 | Phosphorylation | LKKFSGKTLEENKEE HHHHCCCCHHHCCCC | 42.82 | - | |
| 168 | O-linked_Glycosylation | RSDVVPMTAENFRCL CCCCCCCCCCCEEEE | 25.42 | 30059200 | |
| 187 | Phosphorylation | KGFGFKGSSFHRIIP CCCCCCCCCCHHHCC | 30.35 | 27717184 | |
| 188 | Phosphorylation | GFGFKGSSFHRIIPQ CCCCCCCCCHHHCCH | 33.47 | 27717184 | |
| 218 | Acetylation | GKSIYGKKFDDENFI CCCCCCEECCCCCEE | 50.06 | 23806337 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIE_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIE_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIE_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PPIE_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
