UniProt ID | PPIA_RAT | |
---|---|---|
UniProt AC | P10111 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase A | |
Gene Name | Ppia | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 164 | |
Subcellular Localization | Cytoplasm. Secreted. Secretion occurs in response to oxidative stress in vascular smooth muscle through a vesicular secretory pathway that involves actin remodeling and myosin II activation, and mediates ERK1/2 activation.. | |
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
Protein Sequence | MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MVNPTVFF -------CCCCEEEE | 6.24 | - | |
2 | Acetylation | ------MVNPTVFFD ------CCCCEEEEE | 13.61 | - | |
28 | Acetylation | CFELFADKVPKTAEN HHHHHHCCCCCHHHH | 57.94 | 25786129 | |
28 | Ubiquitination | CFELFADKVPKTAEN HHHHHHCCCCCHHHH | 57.94 | - | |
31 | Ubiquitination | LFADKVPKTAENFRA HHHCCCCCHHHHHHH | 64.45 | - | |
31 | Acetylation | LFADKVPKTAENFRA HHHCCCCCHHHHHHH | 64.45 | 26302492 | |
40 | Phosphorylation | AENFRALSTGEKGFG HHHHHHCCCCCCCCC | 33.12 | 23298284 | |
44 | Ubiquitination | RALSTGEKGFGYKGS HHCCCCCCCCCCCCC | 61.97 | - | |
44 | Acetylation | RALSTGEKGFGYKGS HHCCCCCCCCCCCCC | 61.97 | 25786129 | |
49 | Acetylation | GEKGFGYKGSSFHRI CCCCCCCCCCCCCEE | 53.33 | 5806815 | |
49 | Ubiquitination | GEKGFGYKGSSFHRI CCCCCCCCCCCCCEE | 53.33 | - | |
51 | Phosphorylation | KGFGYKGSSFHRIIP CCCCCCCCCCCEEEC | 26.19 | 27097102 | |
52 | Phosphorylation | GFGYKGSSFHRIIPG CCCCCCCCCCEEECC | 33.47 | 27097102 | |
76 | Acetylation | RHNGTGGKSIYGEKF EECCCCCCCCCCCEE | 34.72 | 22902405 | |
76 | Ubiquitination | RHNGTGGKSIYGEKF EECCCCCCCCCCCEE | 34.72 | - | |
77 | Phosphorylation | HNGTGGKSIYGEKFE ECCCCCCCCCCCEEC | 25.07 | 23984901 | |
79 | Phosphorylation | GTGGKSIYGEKFEDE CCCCCCCCCCEECCC | 26.73 | 23984901 | |
82 | Ubiquitination | GKSIYGEKFEDENFI CCCCCCCEECCCCEE | 50.09 | - | |
82 | Acetylation | GKSIYGEKFEDENFI CCCCCCCEECCCCEE | 50.09 | 22902405 | |
91 | Acetylation | EDENFILKHTGPGIL CCCCEEEEECCCCHH | 34.01 | 26302492 | |
93 | Phosphorylation | ENFILKHTGPGILSM CCEEEEECCCCHHHC | 43.41 | - | |
108 | N-linked_Glycosylation | ANAGPNTNGSQFFIC CCCCCCCCCCCEEEE | 55.55 | - | |
125 | Acetylation | KTEWLDGKHVVFGKV ECEEECCCEEEEEEH | 32.66 | 22902405 | |
131 | Acetylation | GKHVVFGKVKEGMSI CCEEEEEEHHHCCCH | 38.37 | 25786129 | |
133 | Acetylation | HVVFGKVKEGMSIVE EEEEEEHHHCCCHHH | 52.62 | 22902405 | |
137 | Phosphorylation | GKVKEGMSIVEAMER EEHHHCCCHHHHHHH | 34.05 | 25403869 | |
155 | Succinylation | RNGKTSKKITISDCG CCCCCCCEEEECCCC | 44.86 | 26843850 | |
157 | Phosphorylation | GKTSKKITISDCGQL CCCCCEEEECCCCCC | 24.25 | 23984901 | |
159 | Phosphorylation | TSKKITISDCGQL-- CCCEEEECCCCCC-- | 20.42 | 23984901 | |
161 | S-nitrosocysteine | KKITISDCGQL---- CEEEECCCCCC---- | 2.74 | - | |
161 | S-nitrosylation | KKITISDCGQL---- CEEEECCCCCC---- | 2.74 | 22178444 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIA_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
125 | K | Acetylation |
| - |
125 | K | Acetylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIA_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PPIA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...