dbPTM

PPCEL_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PPCEL_RAT
UniProt AC	Q5HZA6
Protein Name	Prolyl endopeptidase-like
Gene Name	Prepl
Organism	Rattus norvegicus (Rat).
Sequence Length	726
Subcellular Localization	Cytoplasm, cytosol .
Protein Description	Probable serine peptidase whose precise substrate specificity remains unclear. Does not cleave peptides after a arginine or lysine residue. May play a role in the regulation of synaptic vesiscle exocytosis..
Protein Sequence	MQQTTKLFLGALKYSIPHLGKCMPKQNYCNVADPYYNRLRLKNYRLTKCLQNKPKISELARNIPSRSFSVKDKLEKPESLQKRGINICMDAFEKVRTRLETQPQEEYEIVNAEIKHGGFVYYQEGCCLVRSKDEEADSDNYEVLFNLEELKLEQPFIDCIRVAPDEKYVAAKIRAEDSETSTCIVVKLSDQPAMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPPMLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFKLMRTAADAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNMKPQHYPSVHITAYENDERVPLKGIVNYTEKLKEAVAEHSKGAGEGYQPPNIVLDIQPGGNHVIEDSHKKITTQMKFLYDELGLDSTDAFEALKKYLKV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Phosphorylation	EGCCLVRSKDEEADS CCEEEEEECCCCCCC	36.66	28432305
138	Phosphorylation	SKDEEADSDNYEVLF ECCCCCCCCCEEEEE	34.50	28551015
141	Phosphorylation	EEADSDNYEVLFNLE CCCCCCCEEEEEEHH	16.65	28432305
425	Acetylation	TYKFAEGKLFEETGH EEEEECCCEECCCCC	41.32	22902405
438	Ubiquitination	GHEDPITKTSRVLRI CCCCCCCCCEEEEEE	45.26	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PPCEL_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PPCEL_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PPCEL_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PPCEL_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PPCEL_RAT

Related Literatures of Post-Translational Modification