dbPTM

PPAN_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PPAN_DROME
UniProt AC	Q9VDE5
Protein Name	Protein Peter pan
Gene Name	ppan
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	460
Subcellular Localization
Protein Description	Required for initiation of larval growth and normal mitotic growth but is not absolutely required for general biosynthesis or DNA replication. Required for progression of normal oogenesis and maturation of some imaginal tissues into adult structures..
Protein Sequence	MGGKKKVHPKTRTAAFKASEPSEIVEAPHSFVIHRGLACPYITDLTLDFRRIMEPFTASNLREKRMNRIKDFVSLSSFFHVSHMGIFNKASTQLSFKVVRLPRGPSLTFKVHQFTLARDVISLSKKQMIDNDHFKHAPLVIMNNFSGDGKHLKLMATTFQNMFPSINLATVNIGTIRRCVLFSYNPDTKLVEMRHYSVQVVPVGLKRAVQKIVKGTVPNLGKCNEVVDFVTKDGYASESEAEDDEQSHVVLAQTLKSKGNLEDKKSSIKLHEIGPRLTMQLIKIEEGLLTGEVLYHDHVVKTEDEKETLRKLVEKKRKQKEQRKKEQAENRARNLKLKKDEKWAAKRAAEGRTDSDPEDDAEYYKEEVGEEPDEELFKMEAKSSRKRPSLGGGMKYKNKRAKLDTKDKNDKSERTDKYDRKDKFDRKDKKDKFDPKNRRAKFDPKNKRAKFDHRKSRKSK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
235	Phosphorylation	DFVTKDGYASESEAE EECCCCCCCCHHHCC	19.65	19429919
237	Phosphorylation	VTKDGYASESEAEDD CCCCCCCCHHHCCCC	32.92	19429919
239	Phosphorylation	KDGYASESEAEDDEQ CCCCCCHHHCCCCHH	39.34	19429919
353	Phosphorylation	KRAAEGRTDSDPEDD HHHHCCCCCCCHHHH	51.19	19429919
355	Phosphorylation	AAEGRTDSDPEDDAE HHCCCCCCCHHHHHH	55.22	19429919
389	Phosphorylation	KSSRKRPSLGGGMKY HHCCCCCCCCCCCCC	43.62	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PPAN_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PPAN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PPAN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PPAN_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-237; SER-239; THR-353AND SER-355, AND MASS SPECTROMETRY.	18327897 [Abstract]
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-355, AND MASSSPECTROMETRY.	17372656 [Abstract]