UniProt ID | PPAN_DROME | |
---|---|---|
UniProt AC | Q9VDE5 | |
Protein Name | Protein Peter pan | |
Gene Name | ppan | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 460 | |
Subcellular Localization | ||
Protein Description | Required for initiation of larval growth and normal mitotic growth but is not absolutely required for general biosynthesis or DNA replication. Required for progression of normal oogenesis and maturation of some imaginal tissues into adult structures.. | |
Protein Sequence | MGGKKKVHPKTRTAAFKASEPSEIVEAPHSFVIHRGLACPYITDLTLDFRRIMEPFTASNLREKRMNRIKDFVSLSSFFHVSHMGIFNKASTQLSFKVVRLPRGPSLTFKVHQFTLARDVISLSKKQMIDNDHFKHAPLVIMNNFSGDGKHLKLMATTFQNMFPSINLATVNIGTIRRCVLFSYNPDTKLVEMRHYSVQVVPVGLKRAVQKIVKGTVPNLGKCNEVVDFVTKDGYASESEAEDDEQSHVVLAQTLKSKGNLEDKKSSIKLHEIGPRLTMQLIKIEEGLLTGEVLYHDHVVKTEDEKETLRKLVEKKRKQKEQRKKEQAENRARNLKLKKDEKWAAKRAAEGRTDSDPEDDAEYYKEEVGEEPDEELFKMEAKSSRKRPSLGGGMKYKNKRAKLDTKDKNDKSERTDKYDRKDKFDRKDKKDKFDPKNRRAKFDPKNKRAKFDHRKSRKSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
235 | Phosphorylation | DFVTKDGYASESEAE EECCCCCCCCHHHCC | 19.65 | 19429919 | |
237 | Phosphorylation | VTKDGYASESEAEDD CCCCCCCCHHHCCCC | 32.92 | 19429919 | |
239 | Phosphorylation | KDGYASESEAEDDEQ CCCCCCHHHCCCCHH | 39.34 | 19429919 | |
353 | Phosphorylation | KRAAEGRTDSDPEDD HHHHCCCCCCCHHHH | 51.19 | 19429919 | |
355 | Phosphorylation | AAEGRTDSDPEDDAE HHCCCCCCCHHHHHH | 55.22 | 19429919 | |
389 | Phosphorylation | KSSRKRPSLGGGMKY HHCCCCCCCCCCCCC | 43.62 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPAN_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPAN_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPAN_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-237; SER-239; THR-353AND SER-355, AND MASS SPECTROMETRY. | |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-355, AND MASSSPECTROMETRY. |