UniProt ID | PPAC_MOUSE | |
---|---|---|
UniProt AC | Q9D358 | |
Protein Name | Low molecular weight phosphotyrosine protein phosphatase | |
Gene Name | Acp1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 158 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.. | |
Protein Sequence | MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEVGSKSV ------CCCCCCCEE | 21.85 | - | |
35 | Acetylation | RKLVTDEKVSDNWRI HHHCCCCCCCCCEEE | 50.26 | 23954790 | |
35 | Ubiquitination | RKLVTDEKVSDNWRI HHHCCCCCCCCCEEE | 50.26 | - | |
49 | Phosphorylation | IDSAATSTYEVGNPP ECCCCCCEEECCCCC | 21.24 | 24224561 | |
62 (in isoform 2) | Phosphorylation | - | 25.11 | 25367039 | |
66 | Acetylation | RGQNCMRKHGIHMQH CCCCHHHHCCCCHHH | 21.21 | 22826441 | |
88 | Phosphorylation | EDFATFDYILCMDES HHHCCCCEEEEECHH | 7.50 | 75123 | |
113 | Ubiquitination | QVKNCKAKIELLGSY HHCCHHHHHHCCCCC | 23.39 | - | |
132 | Phosphorylation | QLIIEDPYYGNDSDF CEEEECCCCCCCCHH | 36.01 | 22817900 | |
133 | Phosphorylation | LIIEDPYYGNDSDFE EEEECCCCCCCCHHH | 18.16 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPAC_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPAC_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPAC_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CTNB1_MOUSE | Ctnnb1 | physical | 12438242 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...