| UniProt ID | PP2AB_RAT | |
|---|---|---|
| UniProt AC | P62716 | |
| Protein Name | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform | |
| Gene Name | Ppp2cb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 309 | |
| Subcellular Localization | Cytoplasm. Nucleus. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle pole. In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles (By similarity).. | |
| Protein Description | PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.. | |
| Protein Sequence | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Ubiquitination | VEQLNECKQLNENQV HHHHHHHHHCCHHHH | 52.20 | - | |
| 36 | Acetylation | RTLCEKAKEILTKES HHHHHHHHHHHHCCC | 57.25 | 22902405 | |
| 41 | Acetylation | KAKEILTKESNVQEV HHHHHHHCCCCCCEE | 56.55 | 22902405 | |
| 41 | Ubiquitination | KAKEILTKESNVQEV HHHHHHHCCCCCCEE | 56.55 | - | |
| 74 | Ubiquitination | ELFRIGGKSPDTNYL HHHHCCCCCCCCCEE | 54.31 | - | |
| 75 | Phosphorylation | LFRIGGKSPDTNYLF HHHCCCCCCCCCEEE | 31.14 | 28689409 | |
| 78 | Phosphorylation | IGGKSPDTNYLFMGD CCCCCCCCCEEECCC | 29.19 | 28689409 | |
| 212 | Phosphorylation | DRGGWGISPRGAGYT CCCCCCCCCCCCCCC | 12.47 | 22108457 | |
| 248 | Phosphorylation | HQLVMEGYNWCHDRN HHHHHCCCCCCCCCC | 7.68 | - | |
| 283 | Ubiquitination | MELDDTLKYSFLQFD EECCCCCEEEEEECC | 40.72 | - | |
| 284 | Phosphorylation | ELDDTLKYSFLQFDP ECCCCCEEEEEECCC | 14.04 | - | |
| 304 | Phosphorylation | EPHVTRRTPDYFL-- CCCCCCCCCCCCC-- | 19.74 | 21738781 | |
| 307 | Phosphorylation | VTRRTPDYFL----- CCCCCCCCCC----- | 14.16 | 15661743 | |
| 309 | Methylation | RRTPDYFL------- CCCCCCCC------- | 5.81 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2AB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2AB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2AB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PP2AB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
