dbPTM

PP2A4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PP2A4_ARATH
UniProt AC	P48578
Protein Name	Serine/threonine-protein phosphatase PP2A-4 catalytic subunit
Gene Name	PP2A4 {ECO:0000303\|PubMed:9524239}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	313
Subcellular Localization	Cytoplasm.
Protein Description	Functions redundantly with PP2A3, and is involved in establishing auxin gradients, apical-basal axis of polarity and root and shoot apical meristem during embryogenesis. May dephosphorylate PIN1 and regulate its subcellular distribution for polar auxin transport. [PubMed: 23167545 The holoenzyme composed of PP2AA1, PP2A4 and B'ZETA or B'ETA acts as negative regulator of plant innate immunity by controlling BAK1 phosphorylation state and activation in surface-localized immune receptor complexes]
Protein Sequence	MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKLIARAHQLVMDGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
313	Methylation	RRTPDYFL------- CCCCCCCC-------	5.81	28741704

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PP2A4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PP2A4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PP2A4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KAN1_ARATH	KAN	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PP2A4_ARATH

Related Literatures of Post-Translational Modification