| UniProt ID | PP13G_HUMAN | |
|---|---|---|
| UniProt AC | B7ZBB8 | |
| Protein Name | Protein phosphatase 1 regulatory subunit 3G | |
| Gene Name | PPP1R3G | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 358 | |
| Subcellular Localization | ||
| Protein Description | Glycogen-targeting subunit for protein phosphatase 1 (PP1). Involved in the regulation of hepatic glycogenesis in a manner coupled to the fasting-feeding cycle and distinct from other glycogen-targeting subunits (By similarity).. | |
| Protein Sequence | MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | EPIGARLSLEAPGPA CCCCCEEEECCCCCC | 20.71 | 28355574 | |
| 62 | Acetylation | GDRPLSPKEEAAPQE CCCCCCHHHHCCHHH | 65.88 | 11481881 | |
| 84 | Phosphorylation | RRRCRARSFSLPADP HHHHHHHHCCCCCHH | 20.43 | 22617229 | |
| 86 | Phosphorylation | RCRARSFSLPADPIL HHHHHHCCCCCHHHH | 34.39 | 28355574 | |
| 141 | Phosphorylation | FADTLGLSLASVKHF HHHHHCCCHHHCCCC | 21.79 | 28857561 | |
| 166 | Phosphorylation | AVLSRLRSFPMRAED HHHHHHHHCCCCHHH | 37.99 | 27251275 | |
| 191 | Phosphorylation | AAVAAPLSAPPSRLR HHHHHCCCCCHHHCC | 37.36 | 28111955 | |
| 195 | Phosphorylation | APLSAPPSRLRPLFQ HCCCCCHHHCCHHHC | 42.77 | 28111955 | |
| 338 | Phosphorylation | YRCAQGEYWDNNAGA CHHHCCCCCCCCCCC | 25.53 | - | |
| 348 | Phosphorylation | NNAGANYTLRYARPA CCCCCCCEEEECCCH | 12.45 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP13G_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP13G_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP13G_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PP13G_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
