UniProt ID | PP13G_HUMAN | |
---|---|---|
UniProt AC | B7ZBB8 | |
Protein Name | Protein phosphatase 1 regulatory subunit 3G | |
Gene Name | PPP1R3G | |
Organism | Homo sapiens (Human). | |
Sequence Length | 358 | |
Subcellular Localization | ||
Protein Description | Glycogen-targeting subunit for protein phosphatase 1 (PP1). Involved in the regulation of hepatic glycogenesis in a manner coupled to the fasting-feeding cycle and distinct from other glycogen-targeting subunits (By similarity).. | |
Protein Sequence | MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | EPIGARLSLEAPGPA CCCCCEEEECCCCCC | 20.71 | 28355574 | |
62 | Acetylation | GDRPLSPKEEAAPQE CCCCCCHHHHCCHHH | 65.88 | 11481881 | |
84 | Phosphorylation | RRRCRARSFSLPADP HHHHHHHHCCCCCHH | 20.43 | 22617229 | |
86 | Phosphorylation | RCRARSFSLPADPIL HHHHHHCCCCCHHHH | 34.39 | 28355574 | |
141 | Phosphorylation | FADTLGLSLASVKHF HHHHHCCCHHHCCCC | 21.79 | 28857561 | |
166 | Phosphorylation | AVLSRLRSFPMRAED HHHHHHHHCCCCHHH | 37.99 | 27251275 | |
191 | Phosphorylation | AAVAAPLSAPPSRLR HHHHHCCCCCHHHCC | 37.36 | 28111955 | |
195 | Phosphorylation | APLSAPPSRLRPLFQ HCCCCCHHHCCHHHC | 42.77 | 28111955 | |
338 | Phosphorylation | YRCAQGEYWDNNAGA CHHHCCCCCCCCCCC | 25.53 | - | |
348 | Phosphorylation | NNAGANYTLRYARPA CCCCCCCEEEECCCH | 12.45 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP13G_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP13G_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP13G_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PP13G_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...