dbPTM

PORED_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PORED_MOUSE
UniProt AC	Q9WUP4
Protein Name	Polyprenol reductase
Gene Name	Srd5a3
Organism	Mus musculus (Mouse).
Sequence Length	330
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT)..
Protein Sequence	MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQFQALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQALSAFFNHKFYRSTFVSYPKHRKAFLPFLF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	S-palmitoylation	PARLLPSCALFQDLL HHHHCHHHHHHHHHH	3.44	28526873
128	Ubiquitination	QALEMESKASRMPAA HHHHHHHHHHCCCHH	36.75	22790023
317	Phosphorylation	FYRSTFVSYPKHRKA HHHHHCCCCHHHHHC	31.37	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PORED_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PORED_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PORED_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PORED_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PORED_MOUSE

Related Literatures of Post-Translational Modification