| UniProt ID | PORED_HUMAN | |
|---|---|---|
| UniProt AC | Q9H8P0 | |
| Protein Name | Polyprenol reductase | |
| Gene Name | SRD5A3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 318 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).. | |
| Protein Sequence | MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 56 | Ubiquitination | LIRYGKTKCGEPSRP HHHHCCCCCCCCCCC | 43.67 | - | |
| 73 | Ubiquitination | CRAFDVPKRYFSHFY HHHCCCCHHHHCCHH | 60.63 | - | |
| 189 | Phosphorylation | PMDGRNAYITGKNLL CCCCCCEEECCCHHH | 11.54 | - | |
| 193 | Acetylation | RNAYITGKNLLMQAR CCEEECCCHHHHHHH | 35.45 | 20167786 | |
| 193 | Ubiquitination | RNAYITGKNLLMQAR CCEEECCCHHHHHHH | 35.45 | - | |
| 229 | Acetylation | VILGNLRKNKAGVVI EEECCCCCCCCEEEE | 67.00 | 20167786 | |
| 302 | Ubiquitination | SHQFYKSKFVSYPKH HHHHHHHHCCCCHHH | 45.71 | - | |
| 302 | Malonylation | SHQFYKSKFVSYPKH HHHHHHHHCCCCHHH | 45.71 | 26320211 | |
| 305 | Phosphorylation | FYKSKFVSYPKHRKA HHHHHCCCCHHHHHC | 38.56 | 24719451 | |
| 308 | Ubiquitination | SKFVSYPKHRKAFLP HHCCCCHHHHHCCCC | 48.05 | 29967540 | |
| 311 | Ubiquitination | VSYPKHRKAFLPFLF CCCHHHHHCCCCCCC | 43.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PORED_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PORED_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PORED_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PORED_HUMAN !! | ||||
| Kegg Disease | |
|---|---|
| H00118 | Congenital disorders of glycosylation (CDG) type I |
| OMIM Disease | |
| 612379 | Congenital disorder of glycosylation 1Q (CDG1Q) |
| 612713 | Kahrizi syndrome (KHRZ) |
| Kegg Drug | |
| D00321 | Finasteride (JAN/USP/INN); Propecia (TN); Proscar (TN) |
| D01134 | Epristeride (JAN/USAN/INN) |
| D04498 | Idronoxil (USAN/INN) |
| DrugBank | |
| DB00421 | Spironolactone |
loading...
