dbPTM

PORB_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PORB_ARATH
UniProt AC	P21218
Protein Name	Protochlorophyllide reductase B, chloroplastic
Gene Name	PORB
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	401
Subcellular Localization	Plastid, chloroplast outer membrane. Plastid, chloroplast thylakoid membrane.
Protein Description	Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide)..
Protein Sequence	MALQAASLVSSAFSVRKDAKLNASSSSFKDSSLFGASITDQIKSEHGSSSLRFKREQSLRNLAIRAQTAATSSPTVTKSVDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWNVIMACRDFLKAERAAKSVGMPKDSYTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPTAKEPTYSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAGGLNGLNSSAMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGVTFASLYPGCIASTGLFREHIPLFRALFPPFQKYITKGYVSETESGKRLAQVVSDPSLTKSGVYWSWNNASASFENQLSEEASDVEKARKVWEISEKLVGLA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Pyrrolidone_carboxylic_acid	RNLAIRAQTAATSSP HHHHHHHHHHCCCCC	23.09	-
67	Pyrrolidone_carboxylic_acid	RNLAIRAQTAATSSP HHHHHHHHHHCCCCC	23.09	22223895
67	Pyrrolidone_carboxylic_acid	RNLAIRAQTAATSSP HHHHHHHHHHCCCCC	23.09	22223895
338	Phosphorylation	QKYITKGYVSETESG HHHHHCCCCCCCCCC	11.45	23776212
340	Phosphorylation	YITKGYVSETESGKR HHHCCCCCCCCCCCC	30.25	23776212
342	Phosphorylation	TKGYVSETESGKRLA HCCCCCCCCCCCCEE	28.13	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PORB_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PORB_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PORB_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PORB_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PORB_ARATH

Related Literatures of Post-Translational Modification