UniProt ID | PO3F4_MOUSE | |
---|---|---|
UniProt AC | P62515 | |
Protein Name | POU domain, class 3, transcription factor 4 | |
Gene Name | Pou3f4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 361 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain.. | |
Protein Sequence | MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDASCHDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MATAASNPYSILS --CCCCCCCCCCCCC | 35.55 | 24719451 | |
22 | Phosphorylation | SSLVHADSAGMQQGS CCCCEECCCCCCCCC | 27.75 | 24759943 | |
29 | Phosphorylation | SAGMQQGSPFRNPQK CCCCCCCCCCCCHHH | 19.27 | 24759943 | |
241 | Phosphorylation | RFEALQLSFKNMCKL HHHHHHHHHHHHHHH | 22.63 | 23140645 | |
261 | Phosphorylation | KWLEEADSSTGSPTS HHHHHHHCCCCCCCH | 36.53 | 29899451 | |
263 | Phosphorylation | LEEADSSTGSPTSID HHHHHCCCCCCCHHH | 45.70 | 29899451 | |
265 | Phosphorylation | EADSSTGSPTSIDKI HHHCCCCCCCHHHHH | 25.70 | 30372032 | |
267 | Phosphorylation | DSSTGSPTSIDKIAA HCCCCCCCHHHHHHH | 39.76 | 30372032 | |
268 | Phosphorylation | SSTGSPTSIDKIAAQ CCCCCCCHHHHHHHC | 31.97 | 29899451 | |
283 | Phosphorylation | GRKRKKRTSIEVSVK CCCCCCCCCCEEEHH | 42.83 | 29899451 | |
284 | Phosphorylation | RKRKKRTSIEVSVKG CCCCCCCCCEEEHHH | 22.30 | - | |
337 | Phosphorylation | RQKEKRMTPPGDQQP CHHCCCCCCCCCCCC | 30.30 | 28576409 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PO3F4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PO3F4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PO3F4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PO3F4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...