| UniProt ID | PNPH_MOUSE | |
|---|---|---|
| UniProt AC | P23492 | |
| Protein Name | Purine nucleoside phosphorylase | |
| Gene Name | Pnp | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 289 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.. | |
| Protein Sequence | MENEFTYEDYETTAKWLLQHTEYRPQVAVICGSGLGGLTAHLKEAQIFDYNEIPNFPQSTVQGHAGRLVFGLLNGRCCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFTAWKQMGEQRKLQEGTYVMLAGPNFETVAESRLLKMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYENLEKANHMEVLDAGKAAAQTLERFVSILMESIPLPDRGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MENEFTYE -------CCCCCCHH | 12.92 | - | |
| 95 | Ubiquitination | YEGYSLSKVTFPVRV EECCCCCEEEECEEE | 51.06 | - | |
| 142 | S-nitrosocysteine | HINLPGFCGQNPLRG CCCCCCCCCCCCCCC | 7.31 | - | |
| 142 | S-nitrosylation | HINLPGFCGQNPLRG CCCCCCCCCCCCCCC | 7.31 | 20925432 | |
| 142 | S-palmitoylation | HINLPGFCGQNPLRG CCCCCCCCCCCCCCC | 7.31 | 28526873 | |
| 179 | Acetylation | QKAFTAWKQMGEQRK HHHHHHHHHHHHHHC | 28.13 | 22826441 | |
| 186 | Ubiquitination | KQMGEQRKLQEGTYV HHHHHHHCCCCCCEE | 54.97 | - | |
| 210 | Ubiquitination | VAESRLLKMLGADAV HHHHHHHHHHCCCCC | 36.35 | - | |
| 244 | Acetylation | GFSLITNKVVMDYEN EEEEECCCEECCHHH | 27.79 | 19859067 | |
| 254 | Ubiquitination | MDYENLEKANHMEVL CCHHHHHHCCCHHHH | 58.62 | - | |
| 265 | Ubiquitination | MEVLDAGKAAAQTLE HHHHHHHHHHHHHHH | 36.25 | - | |
| 265 | Malonylation | MEVLDAGKAAAQTLE HHHHHHHHHHHHHHH | 36.25 | 26320211 | |
| 276 | Phosphorylation | QTLERFVSILMESIP HHHHHHHHHHHHCCC | 13.80 | 29472430 | |
| 281 | Phosphorylation | FVSILMESIPLPDRG HHHHHHHCCCCCCCC | 18.62 | 29514104 | |
| 289 | Phosphorylation | IPLPDRGS------- CCCCCCCC------- | 37.63 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNPH_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNPH_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNPH_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PNPH_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
