| UniProt ID | PNOC_HUMAN | |
|---|---|---|
| UniProt AC | Q13519 | |
| Protein Name | Prepronociceptin | |
| Gene Name | PNOC | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 176 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Nociceptin: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.; Nocistatin: Blocks nociceptin action in pain transmission by inhibiting nociceptin-induced hyperalgesia and allodynia.; Orphanin FQ2: Has potent analgesic activity.. | |
| Protein Sequence | MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | Phosphorylation | RRMPRVRSLFQEQEE HHCHHHHHHHHHCCC | 30.58 | - | |
| 134 | Phosphorylation | QKRFGGFTGARKSAR HHHHCCHHHHHHHHH | 32.95 | - | |
| 139 | Phosphorylation | GFTGARKSARKLANQ CHHHHHHHHHHHHHH | 27.96 | - | |
| 156 | Phosphorylation | FSEFMRQYLVLSMQS HHHHHHHHHHHHHHH | 6.60 | 24043423 | |
| 160 | Phosphorylation | MRQYLVLSMQSSQRR HHHHHHHHHHHHHHH | 13.80 | 24043423 | |
| 163 | Phosphorylation | YLVLSMQSSQRRRTL HHHHHHHHHHHHHHH | 21.57 | 24043423 | |
| 164 | Phosphorylation | LVLSMQSSQRRRTLH HHHHHHHHHHHHHHH | 15.71 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNOC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNOC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNOC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PNOC_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
