dbPTM

PNO1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PNO1_SCHPO
UniProt AC	O14044
Protein Name	Pre-rRNA-processing protein pno1
Gene Name	rbp28
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	241
Subcellular Localization	Cytoplasm . Nucleus . Nucleus, nucleolus .
Protein Description	Required for small ribosomal subunit (SSU) synthesis. Has a role in the processing of early nucleolar and late cytoplasmic pre-RNA species..
Protein Sequence	MLAPTAAVNVTNEGENDNVMIDTTRGEIEFSDSAVNGTMDIEGAPKFAPAKTSAEKKRGAKPQMRRVPIPPHRMTPLRNVWPKLYPPLVEHLLLQVRMNTKSRSVELRESKATKDPGALQKGMDFVQAFALGFDIDDAIALLRLDDLYIDTFEIKDVKTLQGDHLSRAIGRIAGQGGKTKFAIENASRTRIVLADSKIHILGGFTNIRIAKDAVVSLILGSPPGKVYANLRNAAARAKERI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	TRGEIEFSDSAVNGT CCCEEEECCCCCCCE	20.19	25720772
52	Phosphorylation	PKFAPAKTSAEKKRG CCCCCCCCCHHHHCC	34.96	28889911
53	Phosphorylation	KFAPAKTSAEKKRGA CCCCCCCCHHHHCCC	33.45	24763107
221	Phosphorylation	VVSLILGSPPGKVYA HHHHHHCCCCCCHHH	25.20	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PNO1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PNO1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PNO1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PNO1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PNO1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-52, AND MASSSPECTROMETRY.	18257517 [Abstract]