| UniProt ID | PNMT_HUMAN | |
|---|---|---|
| UniProt AC | P11086 | |
| Protein Name | Phenylethanolamine N-methyltransferase | |
| Gene Name | PNMT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 282 | |
| Subcellular Localization | ||
| Protein Description | Converts noradrenaline to adrenaline.. | |
| Protein Sequence | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGADRSPN ------CCCCCCCCC | 42.56 | 23090842 | |
| 7 | Phosphorylation | -MSGADRSPNAGAAP -CCCCCCCCCCCCCC | 24.05 | 16363801 | |
| 16 | Phosphorylation | NAGAAPDSAPGQAAV CCCCCCCCCCCHHHH | 34.99 | 22115753 | |
| 25 | Phosphorylation | PGQAAVASAYQRFEP CCHHHHHHHHHHHCC | 22.40 | 22115753 | |
| 27 | Phosphorylation | QAAVASAYQRFEPRA HHHHHHHHHHHCCHH | 9.57 | 22115753 | |
| 35 | Phosphorylation | QRFEPRAYLRNNYAP HHHCCHHHHCCCCCC | 13.89 | 17322306 | |
| 40 | Phosphorylation | RAYLRNNYAPPRGDL HHHHCCCCCCCCCCC | 24.84 | 21888424 | |
| 230 | Phosphorylation | LAGEARLTVVPVSEE ECCCCEEEEEECCHH | 17.57 | 23898821 | |
| 235 | Phosphorylation | RLTVVPVSEEEVREA EEEEEECCHHHHHHH | 32.97 | 23898821 | |
| 248 | Phosphorylation | EALVRSGYKVRDLRT HHHHHCCCCCCCCHH | 13.93 | - | |
| 255 | Phosphorylation | YKVRDLRTYIMPAHL CCCCCCHHHCCCHHH | 25.38 | - | |
| 256 | Phosphorylation | KVRDLRTYIMPAHLQ CCCCCHHHCCCHHHH | 6.70 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNMT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNMT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNMT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PNMT_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
