dbPTM

PMG2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PMG2_ARATH
UniProt AC	Q9M9K1
Protein Name	Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2
Gene Name	At3g08590
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	560
Subcellular Localization	Cytoplasm.
Protein Description	Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate..
Protein Sequence	MGSSGDVNWKLADHPKLPKGKTIGLIVLDGWGESDPDQYNCIHKAPTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGRIYAQGAKLVDLALASGKIYEDEGFKYISQSFEKGTVHLIGLLSDGGVHSRLDQVQLLLKGFAERGAKRIRVHILTDGRDVLDGSSVGFVETLEADLAALRAKGVDAQVASGGGRMYVTMDRYENDWSVVKRGWDAQVLGEAPHKFKSALEAVKTLRAEPGANDQYLPSFVIVDDNGKAVGPIVDGDAVVTFNFRADRMVMHAKALEYKDFDKFDRVRVPDIRYAGMLQYDGELKLPSRYLVSPPLIDRTSGEYLAHNGVRTFACSETVKFGHVTFFWNGNRSGYFNEKLEEYVEIPSDSGISFNVQPKMKALEIAEKARDAILSGKFDQVRVNLPNGDMVGHTGDIEATVVACEAADRAVRTILDAIEQVGGIYVVTADHGNAEDMVKRDKSGKPALDKEGNLQILTSHTLKPVPIAIGGPGLSAGVRFRQDIETPGLANVAATVMNLHGFVAPSDYETSLIEVVEK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MGSSGDVNW ------CCCCCCCCC	30.44	22223895
69	Phosphorylation	RLIKAHGTAVGLPSE EEHHHCCEECCCCCC	14.33	23776212
75	Phosphorylation	GTAVGLPSEDDMGNS CEECCCCCCCCCCCC	59.71	23776212
82	Phosphorylation	SEDDMGNSEVGHNAL CCCCCCCCCCCCCCC	28.12	30291188
375	Phosphorylation	FFWNGNRSGYFNEKL EEECCCCCCCCCHHH	41.67	30407730
377	Phosphorylation	WNGNRSGYFNEKLEE ECCCCCCCCCHHHHH	12.41	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PMG2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PMG2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PMG2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PMG2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PMG2_ARATH

Related Literatures of Post-Translational Modification