PMEI2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PMEI2_ARATH
• UniProt AC: Q9LUV1
• Protein Name: Pectinesterase inhibitor 2 {ECO:0000305}
• Gene Name: PMEI2 {ECO:0000303|PubMed:14675772}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 173
• Subcellular Localization: Secreted, extracellular space, apoplast .
• Protein Description: Inhibits pectin methylesterase (PME) from flowers, siliques and pollen tube..
• Protein Sequence: MAAYLTNRVLMSSLMFFVMTGSLNAQVADIKAICGKAKNQSFCTSYMKSNPKTSGADLQTLANITFGSAQTSASEGFRKIQSLVKTATNPTMKKAYTSCVQHYKSAISSLNDAKQSLASGDGKGLNIKVSAAMEGPSTCEQDMADFKVDPSAVKNSGDFQNICGIVLVISNMM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	N-linked_Glycosylation	AICGKAKNQSFCTSY HHHCCCCCHHHCHHH	47.81	-
63	N-linked_Glycosylation	ADLQTLANITFGSAQ CCHHHHHHCCHHCCC	36.62	-
88	Phosphorylation	QSLVKTATNPTMKKA HHHHHHCCCHHHHHH	47.14	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PMEI2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PMEI2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PMEI2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PMEI2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.