UniProt ID | PMEI2_ARATH | |
---|---|---|
UniProt AC | Q9LUV1 | |
Protein Name | Pectinesterase inhibitor 2 {ECO:0000305} | |
Gene Name | PMEI2 {ECO:0000303|PubMed:14675772} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 173 | |
Subcellular Localization | Secreted, extracellular space, apoplast . | |
Protein Description | Inhibits pectin methylesterase (PME) from flowers, siliques and pollen tube.. | |
Protein Sequence | MAAYLTNRVLMSSLMFFVMTGSLNAQVADIKAICGKAKNQSFCTSYMKSNPKTSGADLQTLANITFGSAQTSASEGFRKIQSLVKTATNPTMKKAYTSCVQHYKSAISSLNDAKQSLASGDGKGLNIKVSAAMEGPSTCEQDMADFKVDPSAVKNSGDFQNICGIVLVISNMM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | N-linked_Glycosylation | AICGKAKNQSFCTSY HHHCCCCCHHHCHHH | 47.81 | - | |
63 | N-linked_Glycosylation | ADLQTLANITFGSAQ CCHHHHHHCCHHCCC | 36.62 | - | |
88 | Phosphorylation | QSLVKTATNPTMKKA HHHHHHCCCHHHHHH | 47.14 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PMEI2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PMEI2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PMEI2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PMEI2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...