UniProt ID | PMEI1_ARATH | |
---|---|---|
UniProt AC | Q9LNF2 | |
Protein Name | Pectinesterase inhibitor 1 {ECO:0000305} | |
Gene Name | PMEI1 {ECO:0000303|PubMed:14675772} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 176 | |
Subcellular Localization | Secreted, extracellular space, apoplast . | |
Protein Description | Inhibits pectin methylesterase (PME) from flowers and siliques. [PubMed: 14675772 Inhibits PME from leaves] | |
Protein Sequence | MAANLRNNAFLSSLMFLLLIGSSYAITSSEMSTICDKTLNPSFCLKFLNTKFASPNLQALAKTTLDSTQARATQTLKKLQSIIDGGVDPRSKLAYRSCVDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVKRLRSVDSSVVNNSKTIKNLCGIALVISNMLPRN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
154 | N-linked_Glycosylation | SVDSSVVNNSKTIKN CCCHHHHCCHHHHHH | 44.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PMEI1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PMEI1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PMEI1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PMEI1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...