PME68_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PME68_ARATH
• UniProt AC: Q8LPF3
• Protein Name: Probable pectinesterase 68
• Gene Name: PME68
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 362
• Subcellular Localization: Secreted, cell wall.
• Protein Description: Acts in the modification of cell walls via demethylesterification of cell wall pectin..
• Protein Sequence: MAQLTNSLNYLFSVSLLLFVSFHCLCFRFSLVAACSNSTDDQQIQHHHHRKWVGPSGHKVITVSLNGHAQFRSVQDAVDSIPKNNNKSITIKIAPGFYREKVVVPATKPYITFKGAGRDVTAIEWHDRASDLGANGQQLRTYQTASVTVYANYFTARNISFTNTAPAPLPGMQGWQAVAFRISGDKAFFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDFIFGNGRSMYKDCELHSIASRFGSIAAHGRTCPEEKTGFAFVGCRVTGTGPLYVGRAMGQYSRIVYAYTYFDALVAHGGWDDWDHKSNKSKTAFFGVYNCYGPGAAATRGVSWARALDYESAHPFIAKSFVNGRHWIAPRDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	N-linked_Glycosylation	SLVAACSNSTDDQQI HHHHHCCCCCCCHHH	49.14	-
86	N-linked_Glycosylation	DSIPKNNNKSITIKI HCCCCCCCCCEEEEE	49.17	-
158	N-linked_Glycosylation	ANYFTARNISFTNTA ECEEEEEECEEECCC	31.62	-
308	N-linked_Glycosylation	DDWDHKSNKSKTAFF CCCCCCCCCCCEEEE	58.38	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PME68_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PME68_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PME68_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PME68_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.