PLY15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PLY15_ARATH
• UniProt AC: Q944R1
• Protein Name: Probable pectate lyase 15
• Gene Name: At4g13710
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 470
• Protein Sequence: MASSSQKLISVCVAVLVVLALTAMIFRNSEISLSRKLKTEVIQSSNSSTMAAIRKLKTEEFQSLNSSTMAATRLDGEPQQQQHAVADDPDMVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIGFGRNAIGGRDGRFYIVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIMNSFKTIDARGSNVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	N-linked_Glycosylation	TEVIQSSNSSTMAAI HHHHHCCCHHHHHHH	45.27	-
65	N-linked_Glycosylation	TEEFQSLNSSTMAAT HHHHHHCCCCCCCEE	38.88	-
106	N-linked_Glycosylation	LVQMSEQNRTARRKL HHHHHHHCCHHHHHH	38.94	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PLY15_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PLY15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PLY15_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PLY15_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.