dbPTM

PLRKT_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PLRKT_MOUSE
UniProt AC	Q9D3P8
Protein Name	Plasminogen receptor (KT)
Gene Name	Plgrkt
Organism	Mus musculus (Mouse).
Sequence Length	147
Subcellular Localization	Cell membrane Multi-pass membrane protein . Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/Plaur.
Protein Description	Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9..
Protein Sequence	MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTKLELPKGLITFESLEKARREQSKLFSDK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
108	Phosphorylation	TLLQRMKSEAEDILE HHHHHHHHHHHHHHH	32.47	29176673
132	Phosphorylation	KGLITFESLEKARRE CCCCCHHHHHHHHHH	37.32	29514104
135	Ubiquitination	ITFESLEKARREQSK CCHHHHHHHHHHHHH	53.11	-
141	Phosphorylation	EKARREQSKLFSDK- HHHHHHHHHHHCCC-	26.94	29176673

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PLRKT_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PLRKT_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PLRKT_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PLRKT_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PLRKT_MOUSE

Related Literatures of Post-Translational Modification