UniProt ID | PLM_MOUSE | |
---|---|---|
UniProt AC | Q9Z239 | |
Protein Name | Phospholemman {ECO:0000250|UniProtKB:P56513} | |
Gene Name | Fxyd1 {ECO:0000312|MGI:MGI:1889273} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 92 | |
Subcellular Localization |
Cell membrane, sarcolemma Single-pass type I membrane protein . Apical cell membrane Single-pass type I membrane protein . Membrane, caveola . Detected in the apical cell membrane in brain. In myocytes, localizes to sarcolemma, t-tubules and inte |
|
Protein Description | Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. [PubMed: 15563542] | |
Protein Sequence | MASPGHILALCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSSRRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | S-palmitoylation | LIILSKRCRCKFNQQ HHHHHHHCCCCCCCC | 7.42 | - | |
62 | Glutathionylation | ILSKRCRCKFNQQQR HHHHHCCCCCCCCCC | 7.26 | - | |
62 | S-palmitoylation | ILSKRCRCKFNQQQR HHHHHCCCCCCCCCC | 7.26 | - | |
70 | Phosphorylation | KFNQQQRTGEPDEEE CCCCCCCCCCCCCCC | 41.37 | 24925903 | |
79 | Phosphorylation | EPDEEEGTFRSSIRR CCCCCCCCHHHHHHH | 21.10 | 24925903 | |
82 | Phosphorylation | EEEGTFRSSIRRLSS CCCCCHHHHHHHHHH | 26.40 | 25521595 | |
83 | Phosphorylation | EEGTFRSSIRRLSSR CCCCHHHHHHHHHHC | 18.83 | 25521595 | |
88 | Phosphorylation | RSSIRRLSSRRR--- HHHHHHHHHCCC--- | 21.71 | 16371442 | |
89 | Phosphorylation | SSIRRLSSRRR---- HHHHHHHHCCC---- | 34.10 | 16371442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
88 | S | Phosphorylation | Kinase | PKCA | P20444 | PSP |
88 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
83 | S | Phosphorylation |
| 17242355 |
88 | S | Palmitoylation |
| - |
88 | S | Phosphorylation |
| - |
88 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLM_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PLM_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...