| UniProt ID | PLM_MOUSE | |
|---|---|---|
| UniProt AC | Q9Z239 | |
| Protein Name | Phospholemman {ECO:0000250|UniProtKB:P56513} | |
| Gene Name | Fxyd1 {ECO:0000312|MGI:MGI:1889273} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 92 | |
| Subcellular Localization |
Cell membrane, sarcolemma Single-pass type I membrane protein . Apical cell membrane Single-pass type I membrane protein . Membrane, caveola . Detected in the apical cell membrane in brain. In myocytes, localizes to sarcolemma, t-tubules and inte |
|
| Protein Description | Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. [PubMed: 15563542] | |
| Protein Sequence | MASPGHILALCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSSRRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | S-palmitoylation | LIILSKRCRCKFNQQ HHHHHHHCCCCCCCC | 7.42 | - | |
| 62 | Glutathionylation | ILSKRCRCKFNQQQR HHHHHCCCCCCCCCC | 7.26 | - | |
| 62 | S-palmitoylation | ILSKRCRCKFNQQQR HHHHHCCCCCCCCCC | 7.26 | - | |
| 70 | Phosphorylation | KFNQQQRTGEPDEEE CCCCCCCCCCCCCCC | 41.37 | 24925903 | |
| 79 | Phosphorylation | EPDEEEGTFRSSIRR CCCCCCCCHHHHHHH | 21.10 | 24925903 | |
| 82 | Phosphorylation | EEEGTFRSSIRRLSS CCCCCHHHHHHHHHH | 26.40 | 25521595 | |
| 83 | Phosphorylation | EEGTFRSSIRRLSSR CCCCHHHHHHHHHHC | 18.83 | 25521595 | |
| 88 | Phosphorylation | RSSIRRLSSRRR--- HHHHHHHHHCCC--- | 21.71 | 16371442 | |
| 89 | Phosphorylation | SSIRRLSSRRR---- HHHHHHHHCCC---- | 34.10 | 16371442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 88 | S | Phosphorylation | Kinase | PKCA | P20444 | PSP |
| 88 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 83 | S | Phosphorylation |
| 17242355 |
| 88 | S | Palmitoylation |
| - |
| 88 | S | Phosphorylation |
| - |
| 88 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLM_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PLM_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...