UniProt ID | PLCX1_HUMAN | |
---|---|---|
UniProt AC | Q9NUJ7 | |
Protein Name | PI-PLC X domain-containing protein 1 | |
Gene Name | PLCXD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 323 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | GQVSASNSFSRLHCR CCCCCCCCCCCCCCC | 23.31 | 23312004 | |
12 | Phosphorylation | VSASNSFSRLHCRNA CCCCCCCCCCCCCCC | 33.48 | 23312004 | |
55 | Ubiquitination | MTYCLNKKSPISHEE HHHHCCCCCCCCHHH | 61.46 | 29967540 | |
102 | Phosphorylation | QLDAGVRYLDLRIAH HHCCCCHHHHHHHHH | 11.36 | - | |
166 | Phosphorylation | LSEDLHEYLVACIKN CCHHHHHHHHHHHHH | 8.84 | 30257219 | |
175 | Ubiquitination | VACIKNIFGDMLCPR HHHHHHHHCCCCCCC | 10.70 | 33845483 | |
227 | Ubiquitination | YWWGNRVKTEALIRY CCCCCCCCHHHHHHH | 37.09 | 27667366 | |
255 | Phosphorylation | FVAGINLTENLQYVL EEEEEECCCCHHHHH | 20.52 | 24043423 | |
260 | Phosphorylation | NLTENLQYVLAHPSE ECCCCHHHHHHCCCH | 10.70 | 24043423 | |
266 | Phosphorylation | QYVLAHPSESLEKMT HHHHHCCCHHHHHCC | 29.92 | 24043423 | |
268 | Phosphorylation | VLAHPSESLEKMTLP HHHCCCHHHHHCCCC | 46.28 | 24043423 | |
273 | Phosphorylation | SESLEKMTLPNLPRL CHHHHHCCCCCCCHH | 50.56 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLCX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLCX1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLCX1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NMT1_HUMAN | NMT1 | physical | 26186194 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...