| UniProt ID | PLCA_HUMAN | |
|---|---|---|
| UniProt AC | Q99943 | |
| Protein Name | 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha | |
| Gene Name | AGPAT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 283 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.. | |
| Protein Sequence | MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 67 | Ubiquitination | GRNVENMKILRLMLL CCCCHHHHHHHHHHH | 50.61 | - | |
| 126 | Ubiquitination | GRCVPIAKRELLWAG CCEEEEHHHHHHHHH | 47.31 | - | |
| 152 | Phosphorylation | IFIDRKRTGDAISVM EEEECCCCCCHHHHH | 42.31 | 24425749 | |
| 157 | Phosphorylation | KRTGDAISVMSEVAQ CCCCCHHHHHHHHHH | 17.31 | 20068231 | |
| 160 | Phosphorylation | GDAISVMSEVAQTLL CCHHHHHHHHHHHHC | 27.11 | 20068231 | |
| 165 | Phosphorylation | VMSEVAQTLLTQDVR HHHHHHHHHCCCCEE | 17.63 | 20068231 | |
| 168 | Phosphorylation | EVAQTLLTQDVRVWV HHHHHHCCCCEEEEE | 26.32 | 20068231 | |
| 191 | Ubiquitination | NGSMLPFKRGAFHLA CCCCCEECCCHHHHH | 48.24 | - | |
| 191 | Acetylation | NGSMLPFKRGAFHLA CCCCCEECCCHHHHH | 48.24 | 25953088 | |
| 225 | Phosphorylation | CKKERRFTSGQCQVR ECCCCCCCCCCCEEE | 30.09 | 69103197 | |
| 270 | Methylation | REISTDGRGGGDYLK HHHCCCCCCCCCCCC | 43.31 | - | |
| 275 | Phosphorylation | DGRGGGDYLKKPGGG CCCCCCCCCCCCCCC | 24.56 | 22817900 | |
| 277 | Ubiquitination | RGGGDYLKKPGGGG- CCCCCCCCCCCCCC- | 51.17 | - | |
| 278 | Ubiquitination | GGGDYLKKPGGGG-- CCCCCCCCCCCCC-- | 46.42 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLCA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLCA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLCA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RNH2A_HUMAN | RNASEH2A | physical | 26186194 | |
| RNH2A_HUMAN | RNASEH2A | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
