UniProt ID | PLAS2_ARATH | |
---|---|---|
UniProt AC | P42699 | |
Protein Name | Plastocyanin major isoform, chloroplastic | |
Gene Name | DRT112 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 167 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Peripheral membrane protein Lumenal side . Loosely bound to the chloroplast thylakoid inner membrane surface (PubMed:11034343). |
|
Protein Description | Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Seems to be the major plastocyanin in Arabidopsis.. | |
Protein Sequence | MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | SATVAIPSFTGLKAS EEEEECCCCCCCCCE | 29.36 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLAS2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLAS2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLAS2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PLAS2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...