PLAS2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PLAS2_ARATH
• UniProt AC: P42699
• Protein Name: Plastocyanin major isoform, chloroplastic
• Gene Name: DRT112
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 167
• Subcellular Localization: Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein ; Lumenal side . Loosely bound to the chloroplast thylakoid inner membrane surface (PubMed:11034343).
• Protein Description: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Seems to be the major plastocyanin in Arabidopsis..
• Protein Sequence: MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	SATVAIPSFTGLKAS EEEEECCCCCCCCCE	29.36	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PLAS2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PLAS2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PLAS2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PLAS2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.