UniProt ID | PLAG1_HUMAN | |
---|---|---|
UniProt AC | Q6DJT9 | |
Protein Name | Zinc finger protein PLAG1 | |
Gene Name | PLAG1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 500 | |
Subcellular Localization | Nucleus . Strong nucleolar localization when sumoylation is inhibited. | |
Protein Description | Transcription factor whose activation results in up-regulation of target genes, such as IGFII, leading to uncontrolled cell proliferation: when overexpressed in cultured cells, higher proliferation rate and transformation are observed. Other target genes such as CRLF1, CRABP2, CRIP2, PIGF are strongly induced in cells with PLAG1 induction. Proto-oncogene whose ectopic expression can trigger the development of pleomorphic adenomas of the salivary gland and lipoblastomas. Overexpression is associated with up-regulation of IGFII, is frequently observed in hepatoblastoma, common primary liver tumor in childhood. Cooperates with CBFB-MYH11, a fusion gene important for myeloid leukemia.. | |
Protein Sequence | MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | GKRKRGETKPRKNFP CCCCCCCCCCCCCCC | 49.53 | - | |
55 | Phosphorylation | KLKVHSYSHTGERPY EECEEECCCCCCCCC | 20.00 | 24719451 | |
57 | Phosphorylation | KVHSYSHTGERPYKC CEEECCCCCCCCCHH | 34.49 | 27251275 | |
85 | Phosphorylation | KLQRHMATHSPEKTH HHHHHHCCCCCCCCC | 18.47 | - | |
87 | Phosphorylation | QRHMATHSPEKTHKC HHHHCCCCCCCCCCC | 30.33 | - | |
91 | Phosphorylation | ATHSPEKTHKCNYCE CCCCCCCCCCCCHHH | 25.55 | - | |
208 | Phosphorylation | RRHMVVHTGRKDFLC HHHEEEECCCHHHHH | 27.37 | - | |
235 | Phosphorylation | LTRHMKKSHNQELLK HHHHHHHHHCHHHHE | 23.35 | 29457462 | |
244 | Sumoylation | NQELLKVKTEPVDFL CHHHHEECCCCCCCC | 45.65 | - | |
244 | Sumoylation | NQELLKVKTEPVDFL CHHHHEECCCCCCCC | 45.65 | - | |
263 | Sumoylation | CNVSVPIKDELLPVM CEEECCCCCCCCCCC | 38.80 | - | |
263 | Sumoylation | CNVSVPIKDELLPVM CEEECCCCCCCCCCC | 38.80 | - | |
331 | Phosphorylation | VHPSHHLSFKYPFSS CCCCCCEEEECCCCC | 18.48 | 24719451 | |
334 | Phosphorylation | SHHLSFKYPFSSTSY CCCEEEECCCCCCEE | 13.90 | 23663014 | |
337 | Phosphorylation | LSFKYPFSSTSYAIS EEEECCCCCCEEEEE | 28.36 | 23663014 | |
338 | Phosphorylation | SFKYPFSSTSYAISI EEECCCCCCEEEEEC | 23.04 | 23663014 | |
339 | Phosphorylation | FKYPFSSTSYAISIP EECCCCCCEEEEECC | 25.26 | 23663014 | |
340 | Phosphorylation | KYPFSSTSYAISIPE ECCCCCCEEEEECCC | 17.95 | 23663014 | |
341 | Phosphorylation | YPFSSTSYAISIPEK CCCCCCEEEEECCCC | 14.19 | 23663014 | |
344 | Phosphorylation | SSTSYAISIPEKEQP CCCEEEEECCCCCCC | 24.74 | 23663014 | |
353 | Sumoylation | PEKEQPLKGEIESYL CCCCCCCCHHHHHHH | 62.27 | - | |
353 | Sumoylation | PEKEQPLKGEIESYL CCCCCCCCHHHHHHH | 62.27 | - | |
399 | Phosphorylation | DDGAGDLSLSKSSIS CCCCCCCCCCCCCEE | 35.02 | 24719451 | |
401 | Phosphorylation | GAGDLSLSKSSISIS CCCCCCCCCCCEECC | 27.41 | 25627689 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLAG1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLAG1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLAG1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PLAG1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...