dbPTM

PLAC8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PLAC8_HUMAN
UniProt AC	Q9NZF1
Protein Name	Placenta-specific gene 8 protein
Gene Name	PLAC8
Organism	Homo sapiens (Human).
Sequence Length	115
Subcellular Localization
Protein Description
Protein Sequence	MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	NECCLCGTSVAMRTL CCCCCCCCHHHHHHH	21.02	29978859
67	Phosphorylation	ECCLCGTSVAMRTLY CCCCCCCHHHHHHHH	7.99	29978859
72	Phosphorylation	GTSVAMRTLYRTRYG CCHHHHHHHHHHCCC	18.30	29978859
74	Phosphorylation	SVAMRTLYRTRYGIP HHHHHHHHHHCCCCC	14.88	29978859

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PLAC8_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PLAC8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PLAC8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PLAC8_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PLAC8_HUMAN

Related Literatures of Post-Translational Modification