UniProt ID | PKHA3_HUMAN | |
---|---|---|
UniProt AC | Q9HB20 | |
Protein Name | Pleckstrin homology domain-containing family A member 3 | |
Gene Name | PLEKHA3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 300 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Peripheral membrane protein . |
|
Protein Description | Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).. | |
Protein Sequence | MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | Ubiquitination | LVALGSSKACLTDTR HHHHCCCCCCCCCCC | 44.83 | - | |
109 | Phosphorylation | KEKEISETSESLKTK HHHHHHHCCHHHHHH | 30.88 | 25690035 | |
196 | Phosphorylation | HHPDPLVSPVSPSPV CCCCCCCCCCCCCHH | 27.54 | 29523821 | |
199 | Phosphorylation | DPLVSPVSPSPVQMM CCCCCCCCCCHHHHH | 24.04 | 29523821 | |
201 | Phosphorylation | LVSPVSPSPVQMMKR CCCCCCCCHHHHHHH | 30.14 | 24719451 | |
209 | Phosphorylation | PVQMMKRSVSHPGSC HHHHHHHCCCCCCCC | 23.58 | 25394399 | |
211 | Phosphorylation | QMMKRSVSHPGSCSS HHHHHCCCCCCCCCC | 25.80 | 25159151 | |
215 | Phosphorylation | RSVSHPGSCSSERSS HCCCCCCCCCCCCCC | 18.44 | 26552605 | |
217 | Phosphorylation | VSHPGSCSSERSSHS CCCCCCCCCCCCCCC | 36.61 | 27251275 | |
218 | Phosphorylation | SHPGSCSSERSSHSI CCCCCCCCCCCCCCC | 41.16 | 26552605 | |
221 | Phosphorylation | GSCSSERSSHSIKEP CCCCCCCCCCCCCCC | 28.49 | 23927012 | |
222 | Phosphorylation | SCSSERSSHSIKEPV CCCCCCCCCCCCCCH | 27.72 | 23927012 | |
224 | Phosphorylation | SSERSSHSIKEPVST CCCCCCCCCCCCHHH | 36.99 | 23401153 | |
226 | Ubiquitination | ERSSHSIKEPVSTLH CCCCCCCCCCHHHHH | 60.01 | 24816145 | |
230 | Phosphorylation | HSIKEPVSTLHRLSQ CCCCCCHHHHHHHHH | 35.65 | 28152594 | |
231 | Phosphorylation | SIKEPVSTLHRLSQR CCCCCHHHHHHHHHH | 27.15 | 30266825 | |
236 | Phosphorylation | VSTLHRLSQRRRRTY HHHHHHHHHHHHCCC | 22.92 | 30266825 | |
242 | Phosphorylation | LSQRRRRTYSDTDSC HHHHHHCCCCCCCCC | 26.09 | 23927012 | |
243 | Phosphorylation | SQRRRRTYSDTDSCS HHHHHCCCCCCCCCC | 11.61 | 23927012 | |
244 | Phosphorylation | QRRRRTYSDTDSCSD HHHHCCCCCCCCCCC | 33.16 | 23401153 | |
246 | Phosphorylation | RRRTYSDTDSCSDIP HHCCCCCCCCCCCCC | 24.71 | 23927012 | |
248 | Phosphorylation | RTYSDTDSCSDIPLE CCCCCCCCCCCCCCC | 20.01 | 23927012 | |
250 | Phosphorylation | YSDTDSCSDIPLEDP CCCCCCCCCCCCCCC | 42.39 | 23927012 | |
264 | Phosphorylation | PDRPVHCSKNTLNGD CCCCCCCCCCCCCCC | 17.67 | 23403867 | |
286 | Ubiquitination | EESRLMAKKQSESED HHHHHHHHHCCCCCC | 37.06 | 24816145 | |
289 | Phosphorylation | RLMAKKQSESEDTLP HHHHHHCCCCCCCCC | 52.55 | 25159151 | |
291 | Phosphorylation | MAKKQSESEDTLPSF HHHHCCCCCCCCCCC | 46.12 | 23927012 | |
294 | Phosphorylation | KQSESEDTLPSFSS- HCCCCCCCCCCCCC- | 36.20 | 28450419 | |
297 | Phosphorylation | ESEDTLPSFSS---- CCCCCCCCCCC---- | 40.65 | 27251275 | |
299 | Phosphorylation | EDTLPSFSS------ CCCCCCCCC------ | 39.20 | 28450419 | |
300 | Phosphorylation | DTLPSFSS------- CCCCCCCC------- | 42.08 | 23403867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PKHA3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PKHA3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PKHA3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PKHA3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-289, AND MASSSPECTROMETRY. |