UniProt ID | PITX2_MOUSE | |
---|---|---|
UniProt AC | P97474 | |
Protein Name | Pituitary homeobox 2 | |
Gene Name | Pitx2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 317 | |
Subcellular Localization | Nucleus. | |
Protein Description | Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform Ptx2c is involved in left-right asymmetry the developing embryo.. | |
Protein Sequence | METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 (in isoform 4) | Phosphorylation | - | 9.30 | 28285833 | |
26 (in isoform 5) | Phosphorylation | - | 14.96 | 26824392 | |
28 (in isoform 5) | Phosphorylation | - | 58.92 | 26824392 | |
29 (in isoform 5) | Phosphorylation | - | 50.75 | 26824392 | |
30 (in isoform 5) | Phosphorylation | - | 44.98 | 26824392 | |
38 | Phosphorylation | EIKKVEFTDSPKSRK CCCEEEECCCCCHHH | 23.28 | 29550500 | |
40 | Phosphorylation | KKVEFTDSPKSRKES CEEEECCCCCHHHHH | 31.04 | 26824392 | |
60 (in isoform 2) | Phosphorylation | - | 26.01 | 26824392 | |
62 (in isoform 2) | Phosphorylation | - | 63.20 | 26824392 | |
63 (in isoform 2) | Phosphorylation | - | 65.63 | 26824392 | |
64 (in isoform 2) | Phosphorylation | - | 54.89 | 26824392 | |
90 | Phosphorylation | KRQRRQRTHFTSQQL HHHHHHHHHCCHHHH | 17.01 | - |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
90 | T | Phosphorylation |
| 20019746 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PITX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KAT5_MOUSE | Kat5 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...