PITX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PITX2_MOUSE
• UniProt AC: P97474
• Protein Name: Pituitary homeobox 2
• Gene Name: Pitx2
• Organism: Mus musculus (Mouse).
• Sequence Length: 317
• Subcellular Localization: Nucleus.
• Protein Description: Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform Ptx2c is involved in left-right asymmetry the developing embryo..
• Protein Sequence: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17 (in isoform 4)	Phosphorylation	-	9.30	28285833
26 (in isoform 5)	Phosphorylation	-	14.96	26824392
28 (in isoform 5)	Phosphorylation	-	58.92	26824392
29 (in isoform 5)	Phosphorylation	-	50.75	26824392
30 (in isoform 5)	Phosphorylation	-	44.98	26824392
38	Phosphorylation	EIKKVEFTDSPKSRK CCCEEEECCCCCHHH	23.28	29550500
40	Phosphorylation	KKVEFTDSPKSRKES CEEEECCCCCHHHHH	31.04	26824392
60 (in isoform 2)	Phosphorylation	-	26.01	26824392
62 (in isoform 2)	Phosphorylation	-	63.20	26824392
63 (in isoform 2)	Phosphorylation	-	65.63	26824392
64 (in isoform 2)	Phosphorylation	-	54.89	26824392
90	Phosphorylation	KRQRRQRTHFTSQQL HHHHHHHHHCCHHHH	17.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
90	T	Phosphorylation	Kinase	AKT2	P31751	PSP
90	T	Phosphorylation	Kinase	AKT2	Q60823	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
90	T	Phosphorylation	Phosphorylation at Thr-90 impairs its association with the CCND1 mRNA-stabilizing complex thus shortening the half-life of CCND1.	20019746

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PITX2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KAT5_MOUSE	Kat5	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.