UniProt ID | PIPNB_MOUSE | |
---|---|---|
UniProt AC | P53811 | |
Protein Name | Phosphatidylinositol transfer protein beta isoform | |
Gene Name | Pitpnb | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 271 | |
Subcellular Localization | Cytoplasm. Golgi apparatus. | |
Protein Description | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.. | |
Protein Sequence | MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MVLIKEFRVVLP ---CCEEEEEEEEEE | 46.79 | - | |
5 | Acetylation | ---MVLIKEFRVVLP ---CCEEEEEEEEEE | 46.79 | 22826441 | |
13 | S-palmitoylation | EFRVVLPCSVQEYQV EEEEEEEECCEEEEC | 5.64 | 28526873 | |
44 | Acetylation | GEGIEVLKNEPYEND CCCEEEECCCCCCCC | 65.52 | 23954790 | |
54 | Acetylation | PYENDGEKGQYTHKI CCCCCCCCCCCCHHH | 57.77 | 23954790 | |
54 | Ubiquitination | PYENDGEKGQYTHKI CCCCCCCCCCCCHHH | 57.77 | - | |
65 | Acetylation | THKIYHLKSKVPAFV CHHHEEHHHCCCEEE | 34.61 | 22826441 | |
86 | Ubiquitination | GSLVFHEKAWNAYPY CCEEEECCCHHHCCC | 50.56 | - | |
94 | S-nitrosocysteine | AWNAYPYCRTIVTNE CHHHCCCEEEEECCC | 2.40 | - | |
94 | S-palmitoylation | AWNAYPYCRTIVTNE CHHHCCCEEEEECCC | 2.40 | 28526873 | |
94 | S-nitrosylation | AWNAYPYCRTIVTNE CHHHCCCEEEEECCC | 2.40 | 21278135 | |
165 | Phosphorylation | EDPALFHSVKTKRGP CCCHHHCCCCCCCCC | 20.27 | 11953429 | |
179 | Malonylation | PLGPNWKKELANTPD CCCCCHHHHHCCCCC | 49.96 | 26320211 | |
187 | S-palmitoylation | ELANTPDCPRMCAYK HHCCCCCCHHHCHHE | 2.13 | 28526873 | |
187 | S-nitrosylation | ELANTPDCPRMCAYK HHCCCCCCHHHCHHE | 2.13 | 21278135 | |
187 | S-nitrosocysteine | ELANTPDCPRMCAYK HHCCCCCCHHHCHHE | 2.13 | - | |
194 | Acetylation | CPRMCAYKLVTIKFK CHHHCHHEEEEEEHH | 20.25 | 22826441 | |
199 | Acetylation | AYKLVTIKFKWWGLQ HHEEEEEEHHHHCCH | 31.37 | 22826441 | |
201 | Acetylation | KLVTIKFKWWGLQSK EEEEEEHHHHCCHHH | 36.71 | 22826441 | |
201 | Ubiquitination | KLVTIKFKWWGLQSK EEEEEEHHHHCCHHH | 36.71 | - | |
215 | Malonylation | KVENFIQKQEKRIFT HHHHHHHHHHHHHHH | 56.46 | 26320211 | |
215 | Acetylation | KVENFIQKQEKRIFT HHHHHHHHHHHHHHH | 56.46 | 22826441 | |
230 | S-nitrosylation | NLHRQLFCWIDKWID HHHHHHHHHHHHHHC | 4.18 | 21278135 | |
230 | S-nitrosocysteine | NLHRQLFCWIDKWID HHHHHHHHHHHHHHC | 4.18 | - | |
230 | S-palmitoylation | NLHRQLFCWIDKWID HHHHHHHHHHHHHHC | 4.18 | 28526873 | |
262 | Phosphorylation | ETMRKKGSVRGTSAA HHHHHHCCCCCCCCC | 19.95 | 26824392 | |
266 | Phosphorylation | KKGSVRGTSAADA-- HHCCCCCCCCCCC-- | 12.48 | 18846507 | |
267 | Phosphorylation | KGSVRGTSAADA--- HCCCCCCCCCCC--- | 25.04 | 18846507 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
165 | S | Phosphorylation | Kinase | PRKCA | P20444 | GPS |
165 | S | Phosphorylation | Kinase | PKC-FAMILY | - | GPS |
262 | S | Phosphorylation | Kinase | PRKCA | P20444 | GPS |
262 | S | Phosphorylation | Kinase | PKC-FAMILY | - | GPS |
262 | S | Phosphorylation | Kinase | PKC | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
262 | S | Phosphorylation |
| 11953429 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIPNB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIPNB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"The Golgi localization of phosphatidylinositol transfer protein betarequires the protein kinase C-dependent phosphorylation of serine 262and is essential for maintaining plasma membrane sphingomyelinlevels."; van Tiel C.M., Westerman J., Paasman M.A., Hoebens M.M., Wirtz K.W.,Snoek G.T.; J. Biol. Chem. 277:22447-22452(2002). Cited for: PHOSPHORYLATION AT SER-262, MUTAGENESIS OF SER-165 AND SER-262, ANDMASS SPECTROMETRY. |