| UniProt ID | PIPNA_RAT | |
|---|---|---|
| UniProt AC | P16446 | |
| Protein Name | Phosphatidylinositol transfer protein alpha isoform | |
| Gene Name | Pitpna | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 271 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.. | |
| Protein Sequence | MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Acetylation | ---MVLLKEYRVILP ---CCEEEEEEEEEE | 48.84 | 22902405 | |
| 50 | Acetylation | LVNEPYEKDDGEKGQ EECCCCCCCCCCCCC | 56.10 | 22902405 | |
| 59 | Phosphorylation | DGEKGQYTHKIYHLQ CCCCCCEEHHHEEHH | 14.59 | 15322105 | |
| 68 | Ubiquitination | KIYHLQSKVPTFVRM HHEEHHHCCCCHHHH | 38.99 | - | |
| 87 | Ubiquitination | GALNIHEKAWNAYPY CCCCHHHHHHHHCCC | 44.53 | - | |
| 105 | Ubiquitination | VITNEYMKEDFLIKI EECCCHHHHCEEEEE | 53.91 | - | |
| 111 | Ubiquitination | MKEDFLIKIETWHKP HHHCEEEEEEECCCC | 36.32 | - | |
| 153 | Acetylation | DRSQVLSKDYKAEED HHHHHHCCCCCCCCC | 62.00 | 22902405 | |
| 153 | Ubiquitination | DRSQVLSKDYKAEED HHHHHHCCCCCCCCC | 62.00 | - | |
| 163 | Acetylation | KAEEDPAKFKSIKTG CCCCCHHHCCCCCCC | 59.73 | 22902405 | |
| 166 | Phosphorylation | EDPAKFKSIKTGRGP CCHHHCCCCCCCCCC | 32.24 | 15322105 | |
| 200 | Acetylation | AYKLVTVKFKWWGLQ EEEEEEEEHHHHHCH | 31.68 | 22902405 | |
| 202 | Acetylation | KLVTVKFKWWGLQNK EEEEEEHHHHHCHHH | 36.00 | 22902405 | |
| 202 | Ubiquitination | KLVTVKFKWWGLQNK EEEEEEHHHHHCHHH | 36.00 | - | |
| 209 | Acetylation | KWWGLQNKVENFIHK HHHHCHHHHHHHHHH | 37.66 | 22902405 | |
| 216 | Acetylation | KVENFIHKQEKRLFT HHHHHHHHHHHHHHH | 56.17 | 22902405 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIPNA_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIPNA_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PIPNA_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...