UniProt ID | PIPNA_RAT | |
---|---|---|
UniProt AC | P16446 | |
Protein Name | Phosphatidylinositol transfer protein alpha isoform | |
Gene Name | Pitpna | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 271 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.. | |
Protein Sequence | MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MVLLKEYRVILP ---CCEEEEEEEEEE | 48.84 | 22902405 | |
50 | Acetylation | LVNEPYEKDDGEKGQ EECCCCCCCCCCCCC | 56.10 | 22902405 | |
59 | Phosphorylation | DGEKGQYTHKIYHLQ CCCCCCEEHHHEEHH | 14.59 | 15322105 | |
68 | Ubiquitination | KIYHLQSKVPTFVRM HHEEHHHCCCCHHHH | 38.99 | - | |
87 | Ubiquitination | GALNIHEKAWNAYPY CCCCHHHHHHHHCCC | 44.53 | - | |
105 | Ubiquitination | VITNEYMKEDFLIKI EECCCHHHHCEEEEE | 53.91 | - | |
111 | Ubiquitination | MKEDFLIKIETWHKP HHHCEEEEEEECCCC | 36.32 | - | |
153 | Acetylation | DRSQVLSKDYKAEED HHHHHHCCCCCCCCC | 62.00 | 22902405 | |
153 | Ubiquitination | DRSQVLSKDYKAEED HHHHHHCCCCCCCCC | 62.00 | - | |
163 | Acetylation | KAEEDPAKFKSIKTG CCCCCHHHCCCCCCC | 59.73 | 22902405 | |
166 | Phosphorylation | EDPAKFKSIKTGRGP CCHHHCCCCCCCCCC | 32.24 | 15322105 | |
200 | Acetylation | AYKLVTVKFKWWGLQ EEEEEEEEHHHHHCH | 31.68 | 22902405 | |
202 | Acetylation | KLVTVKFKWWGLQNK EEEEEEHHHHHCHHH | 36.00 | 22902405 | |
202 | Ubiquitination | KLVTVKFKWWGLQNK EEEEEEHHHHHCHHH | 36.00 | - | |
209 | Acetylation | KWWGLQNKVENFIHK HHHHCHHHHHHHHHH | 37.66 | 22902405 | |
216 | Acetylation | KVENFIHKQEKRLFT HHHHHHHHHHHHHHH | 56.17 | 22902405 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIPNA_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIPNA_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIPNA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...